DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and PBS2

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_568762.6 Gene:PBS2 AraportID:AT5G51700 Length:226 Species:Arabidopsis thaliana

Alignment Length:222 Identity:66/223 (30%)
Similarity:94/223 (42%) Gaps:39/223 (17%)


  Fly     3 QCYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVK 67
            ||...||..:|....|...||:.|...|||||..|.||||.::|.||:.||.|.||...||:..|
plant    11 QCQRIGCNAMFTDDDNPQGSCQFHASGPFFHDGMKEWSCCKQRSHDFSLFLEIPGCKTGKHTTEK 75

  Fly    68 P-----------------PEPEKPVKDESDK--------DEVIEVRAPIREALPRPPIDSPLTVI 107
            |                 |:.....||...:        |...:.:..|::.| ..|..:....|
plant    76 PVLAKSVPKHPVAAPTSSPDANAATKDSCSRCRQGFFCSDHGSQPKEQIKQTL-NTPGQAEEEKI 139

  Fly   108 QPTVAPALKDMVFAVKTPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGM 172
            :| :||.::..|..:..|            ..|||.||..:|....:....|::|||..:||:.:
plant   140 EP-LAPPVQKAVIDINQP------------QVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRL 191

  Fly   173 KFWSCCQKRTSDFSQFMAQKGCTYGEH 199
            :.|.||.....:|.:||....||.|.|
plant   192 RGWKCCDVHVKEFDEFMEIPPCTKGWH 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 28/60 (47%)
CHORD 138..199 CDD:282781 21/61 (34%)
p23_melusin_like 213..301 CDD:107238
PBS2NP_568762.6 CHORD 10..71 CDD:282781 28/60 (47%)
CHORD 157..218 CDD:282781 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H8111
Inparanoid 1 1.050 117 1.000 Inparanoid score I1949
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1163528at2759
OrthoInspector 1 1.000 T192618
orthoMCL 1 0.900 OOG5_129434
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
76.870

Return to query results.
Submit another query.