DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHORD and PBS2

DIOPT Version :9

Sequence 1:NP_651226.1 Gene:CHORD / 42874 FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_568762.6 Gene:PBS2 / 835244 AraportID:AT5G51700 Length:226 Species:Arabidopsis thaliana


Alignment Length:222 Identity:66/222 - (29%)
Similarity:94/222 - (42%) Gaps:39/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QCYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVK 67
            ||...||..:|....|...||:.|...|||||..|.||||.::|.||:.||.|.||...||:..|
plant    11 QCQRIGCNAMFTDDDNPQGSCQFHASGPFFHDGMKEWSCCKQRSHDFSLFLEIPGCKTGKHTTEK 75

  Fly    68 P-----------------PEPEKPVKDESDK--------DEVIEVRAPIREALPRPPIDSPLTVI 107
            |                 |:.....||...:        |...:.:..|::.| ..|..:....|
plant    76 PVLAKSVPKHPVAAPTSSPDANAATKDSCSRCRQGFFCSDHGSQPKEQIKQTL-NTPGQAEEEKI 139

  Fly   108 QPTVAPALKDMVFAVKTPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGM 172
            :| :||.::..|..:..|            ..|||.||..:|....:....|::|||..:||:.:
plant   140 EP-LAPPVQKAVIDINQP------------QVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRL 191

  Fly   173 KFWSCCQKRTSDFSQFMAQKGCTYGEH 199
            :.|.||.....:|.:||....||.|.|
plant   192 RGWKCCDVHVKEFDEFMEIPPCTKGWH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 27/59 (46%)
CHORD 138..199 CDD:282781 21/60 (35%)
p23_melusin_like 213..301 CDD:107238
PBS2NP_568762.6 CHORD 10..71 CDD:398569 27/59 (46%)
CHORD 157..218 CDD:398569 21/60 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3345
eggNOG 1 0.900 - - E1_KOG1667
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8111
Inparanoid 1 1.050 117 1.000 Inparanoid score I2002
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1163528at2759
OrthoFinder 1 1.000 - - FOG0002255
OrthoInspector 1 1.000 - - oto4022
orthoMCL 1 0.900 - - OOG6_102230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1489
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.