DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and itgb1bp2

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_012824140.1 Gene:itgb1bp2 XenbaseID:XB-GENE-952360 Length:375 Species:Xenopus tropicalis

Alignment Length:351 Identity:144/352 (41%)
Similarity:203/352 (58%) Gaps:30/352 (9%)


  Fly     4 CYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVKP 68
            |||:||||.|:|..||.:||..|||.|.||||.||||||.|::.||:|||.|.|||...|||.||
 Frog    21 CYNKGCGQRFNPTDNNADSCLFHPGYPIFHDALKGWSCCKKRTTDFSEFLAIPGCTKGLHSNEKP 85

  Fly    69 PEPEKP-------VKD-ESDKDEVIEVRAP------IREALPRPPIDSPLTVIQPTVAPALKDMV 119
            .||.||       |.| :|::...|.|:.|      ::|   ||.....:..:...|:.:|:..:
 Frog    86 SEPMKPEICGNKGVSDAKSNRTTDIIVQGPKSAEKMLKE---RPSAQEQMQPLVLKVSQSLEKEL 147

  Fly   120 FAVKTPAAQK-----SSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQ 179
            ..:|....:|     .:|.|.||||||:.||...:.|..||.|.|.:|||||:|||||||||||.
 Frog   148 EKLKIKPQEKEVQKVETDQIGVGTTCKHAGCKEVYQGPESDAGTCIHHPGVPVFHEGMKFWSCCN 212

  Fly   180 KRTSDFSQFMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNP 244
            .:||||::|:.|:||..|:|.|:| ...::.|.||||||||::.||:.||||......|.:..|.
 Frog   213 IKTSDFNEFLDQRGCASGKHLWIK-TTGRQAVSCRYDWHQTSSVVVITIYAKTAIPELSHVLANQ 276

  Fly   245 IRLHVNLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFP--NKKL 307
            ..|.:.:.|  |..:.|...:||.|::::..::..:..|||||.:.|.:|.:|..|...  :.::
 Frog   277 TALDIQISF--QGQSEFRKQVELWGVIDIGKSTVSLLPTKVEITMKKADPVTWGRLELSRHSPQI 339

  Fly   308 PVVKKSQVEEKKKQEESDEEFFDLDD 333
            .|.::.|:..:|..|   .||.|.||
 Frog   340 TVEEEPQINPEKPPE---PEFSDDDD 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 37/59 (63%)
CHORD 138..199 CDD:282781 36/61 (59%)
p23_melusin_like 213..301 CDD:107238 32/88 (36%)
itgb1bp2XP_012824140.1 CHORD 19..80 CDD:282781 37/59 (63%)
CHORD 171..232 CDD:282781 36/61 (59%)
p23_melusin_like 245..331 CDD:107238 32/88 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C179617485
eggNOG 1 0.900 E1_KOG1667
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I2763
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1163528at2759
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 1 1.000 T601525
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.760

Return to query results.
Submit another query.