DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and Chordc1

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_080120.1 Gene:Chordc1 MGIID:1914167 Length:331 Species:Mus musculus

Alignment Length:333 Identity:143/334 (43%)
Similarity:214/334 (64%) Gaps:26/334 (8%)


  Fly     4 CYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVKP 68
            ||||||||.|||:.|:|::|.:|||.|.||||.||||||.:::.||::||:|.|||..:|::.||
Mouse     5 CYNRGCGQRFDPEANSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKP 69

  Fly    69 PEPEKPVKDESDKDEVIEVRAPIR----------EALPRPPIDSPLTVIQPTVAPALKDMVFAVK 123
            |||.||....::|.|:.|::...:          ||:.||..|.|:|.::..::.:||..:..:|
Mouse    70 PEPVKPEVKTTEKKELSELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLK 134

  Fly   124 TPAA------QKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQKRT 182
            ..:.      ::.||.|::||:|||.||:.::.|..|....|.||.||||||||||:||||:::|
Mouse   135 LSSGSEEDKKEEDSDEIKIGTSCKNGGCSKTYQGLQSLEEVCVYHSGVPIFHEGMKYWSCCRRKT 199

  Fly   183 SDFSQFMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIRL 247
            |||:.|:||:|||.|:|.|.|::..||||.||:|||||...|.:::|||......|.:|.|...|
Mouse   200 SDFNTFLAQEGCTRGKHVWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSQVEANSTLL 264

  Fly   248 HVNLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKKLPVVKK 312
            :|::||  :....|..:::|.|:::|..:...|..||:||.:.|.||..|::|     :||..||
Mouse   265 NVHIVF--EGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASL-----ELPTTKK 322

  Fly   313 SQVEEKKK 320
               :||:|
Mouse   323 ---QEKQK 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 36/59 (61%)
CHORD 138..199 CDD:282781 36/61 (59%)
p23_melusin_like 213..301 CDD:107238 32/88 (36%)
Chordc1NP_080120.1 Interaction with PPP5C. {ECO:0000269|PubMed:16083881} 2..77 44/72 (61%)
CHORD 3..64 CDD:282781 36/59 (61%)
Interaction with HSP90AA1 and HSP90AB1. {ECO:0000269|PubMed:15642353, ECO:0000269|PubMed:16083881} 65..316 99/258 (38%)
CHORD 155..216 CDD:282781 36/61 (59%)
p23_melusin_like 230..316 CDD:107238 32/93 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1667
Hieranoid 1 1.000
Homologene 1 1.000 H8111
Inparanoid 1 1.050 301 1.000 Inparanoid score I2650
Isobase 1 0.950 0 Normalized mean entropy S3736
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 1 1.000 T616473
orthoMCL 1 0.900 OOG5_129434
Panther 1 1.100 LDO PTHR12621
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3238
TreeFam 1 0.960
1312.810

Return to query results.
Submit another query.