DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and chordc1a

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001020346.1 Gene:chordc1a ZFINID:ZDB-GENE-050626-79 Length:339 Species:Danio rerio

Alignment Length:322 Identity:139/323 (43%)
Similarity:198/323 (61%) Gaps:23/323 (7%)


  Fly     4 CYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVKP 68
            |||:||||.|||:.|.|:||.||||.|.||||.||||||.:::.||::||:|.|||...|:..||
Zfish     5 CYNKGCGQRFDPENNPDDSCTHHPGVPVFHDALKGWSCCKRRTTDFSDFLSIAGCTKGPHNKEKP 69

  Fly    69 PEPEKP-VKDESDKDE-----------VIEVRAPIREALPRPPIDSPLTVIQPTVAPALKDMVFA 121
            .||.|| ||...:|.|           :|:...|: |.:.||..|.||..:|..|||:|...:..
Zfish    70 LEPVKPDVKVSGEKKELEDLKPKFNEYIIQAPKPV-EFIQRPSADEPLVNLQRKVAPSLNQALEK 133

  Fly   122 VK-------TPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQ 179
            ::       ....::....::|||.|||.||..::.|..:|...|.||.||||||||||:||||:
Zfish   134 LRLAEEANHIEEKEEEGSEVKVGTACKNGGCMKTYNGPKTDEEMCLYHSGVPIFHEGMKYWSCCK 198

  Fly   180 KRTSDFSQFMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNP 244
            ::||||:.|::|:||..|.|:|.|:..: ||..||:|||||.:.|.::||||..:.....:|.|.
Zfish   199 RKTSDFNTFLSQEGCNKGSHQWRKDTGN-KVAPCRFDWHQTGSQVTLSIYAKNSNPQLCSVEANS 262

  Fly   245 IRLHVNLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKK 306
            :.|.|:|:|  :....|:|.|.|.|:::||.:..:|..:|||:.:.|.||.||:.|:.|..|
Zfish   263 VSLKVHLIF--EGEKEFELSLSLWGVIDVSKSVVNMMASKVEVVMKKAEPMSWARLDLPPPK 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 37/59 (63%)
CHORD 138..199 CDD:282781 34/61 (56%)
p23_melusin_like 213..301 CDD:107238 35/88 (40%)
chordc1aNP_001020346.1 CHORD 3..64 CDD:282781 37/59 (63%)
CHORD 157..218 CDD:282781 34/61 (56%)
p23_melusin_like 231..317 CDD:107238 35/88 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1667
Hieranoid 1 1.000
Homologene 1 1.000 H8111
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1163528at2759
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 1 1.000 T597318
orthoMCL 1 0.900 OOG5_129434
Panther 1 1.100 O PTHR12621
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.