DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and chordc1

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_012812192.1 Gene:chordc1 XenbaseID:XB-GENE-962949 Length:335 Species:Xenopus tropicalis

Alignment Length:334 Identity:148/335 (44%)
Similarity:214/335 (64%) Gaps:20/335 (6%)


  Fly     4 CYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVKP 68
            ||||||||.:||::|:|:||.:|||.|.||||.||||||.:::.||::||:|.|||...|||.||
 Frog     5 CYNRGCGQRYDPESNSDDSCTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGLHSNEKP 69

  Fly    69 PEPEKP-VKDESDKDEV-----------IEVRAPIREALPRPPIDSPLTVIQPTVAPALKDMVFA 121
            |||.|| ||..|:|.|:           |:...|| |.:.||..|.|:..:|..::.:||..:..
 Frog    70 PEPVKPEVKTTSEKKELADCKPKFNEHFIQAPKPI-ECINRPSSDEPMVKLQLKISASLKQALDK 133

  Fly   122 VK-----TPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQKR 181
            :|     ....::.|..|::||:|||.||..:|.|..|:...|.||.||||||||||:||||:::
 Frog   134 LKLSENDKAVTEEDSGEIKIGTSCKNGGCLKTFAGPQSNEEVCQYHNGVPIFHEGMKYWSCCRRK 198

  Fly   182 TSDFSQFMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIR 246
            ||||:.|::|:|||.|.|.|.|::|.||||.||:|||||.:.|.::||||......|.:|.|...
 Frog   199 TSDFNTFLSQEGCTKGTHLWTKKDDGKKVVPCRHDWHQTGSGVTISIYAKNSLPELSYVEANSTI 263

  Fly   247 LHVNLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKKLPVVK 311
            :::.:||  :....|..:::|.|:|:|:.:...:..|||||.|.|.||.:|:.|..|.:...:.|
 Frog   264 VNIQVVF--EGEKTFQQNVQLWGVVDVAKSYVSLTATKVEIFLKKAEPMTWARLELPQQAPSLPK 326

  Fly   312 KSQVEEKKK 320
            :::..||:|
 Frog   327 QNETSEKQK 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 36/59 (61%)
CHORD 138..199 CDD:282781 36/61 (59%)
p23_melusin_like 213..301 CDD:107238 33/88 (38%)
chordc1XP_012812192.1 CHORD 3..64 CDD:282781 36/59 (61%)
CHORD 155..216 CDD:282781 36/61 (59%)
p23_melusin_like 230..316 CDD:107238 33/88 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1667
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H8111
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1163528at2759
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.790

Return to query results.
Submit another query.