DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and zgc:92429

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001003457.1 Gene:zgc:92429 ZFINID:ZDB-GENE-040801-194 Length:387 Species:Danio rerio

Alignment Length:385 Identity:150/386 (39%)
Similarity:211/386 (55%) Gaps:54/386 (14%)


  Fly     4 CYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVKP 68
            |||||||..||...|.|::||.|||.|.||||.||||||.|::.||:|||:|||||..:|||.||
Zfish     5 CYNRGCGDRFDADKNTDDACRFHPGVPIFHDALKGWSCCKKRTTDFSEFLSIKGCTRGRHSNEKP 69

  Fly    69 PEPEKP--------VKDESDKDEVIEVRAPIREAL--PRPPIDSPLTVIQPTVAPALKDMVFAVK 123
            .||.:|        :|.....:|:|.......|||  .||..|.|.|.:|..::|:|..::..::
Zfish    70 EEPLRPEVTSEKGGMKQHGTAEEIIYQGPKSAEALEKERPSSDEPKTKLQVKISPSLIQIMEKME 134

  Fly   124 TPAAQK----SSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQKRTSD 184
            ....:|    .|.|:.||..|||.||..|:.|..::...|.||||.|:||||.|:|:||..:|:|
Zfish   135 ISEREKREKLESQALVVGIKCKNTGCRKSYEGPETNAEICIYHPGAPVFHEGYKYWNCCCIKTTD 199

  Fly   185 FSQFMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIRLHV 249
            |:.|:.|||||.|:|.|:.:.|.|||. ||:|||||.:.||:.||||..:...|.:|.|...|..
Zfish   200 FNAFLDQKGCTSGKHCWIPKQDKKKVA-CRHDWHQTGSQVVVTIYAKNCNPDHSYVEANRTVLTC 263

  Fly   250 NLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKK-------- 306
            ::.| |.|.. |..|:.|.|:::|.::..:|..:|||:.:.|.:..:|..|..|..|        
Zfish   264 HIQF-EGDKV-FHKDIHLWGVIDVKSSLVNMVPSKVEVSMRKADAVAWGKLEDPKHKPEPELTDN 326

  Fly   307 LPVVKKSQV----------------------EEKKKQEESDEEFFD----LD---DIKAE 337
            :...::.:|                      |||||:|:..||..|    |:   |:|.|
Zfish   327 MNSAEQEEVKPQWDISDDDISESDWEDDEEEEEKKKEEKQKEESGDGPPELEQPADVKQE 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 38/59 (64%)
CHORD 138..199 CDD:282781 31/61 (51%)
p23_melusin_like 213..301 CDD:107238 32/88 (36%)
zgc:92429NP_001003457.1 CHORD 3..64 CDD:282781 38/59 (64%)
CHORD 154..214 CDD:282781 31/60 (52%)
p23_melusin_like 227..313 CDD:107238 32/88 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C179617562
eggNOG 1 0.900 E1_KOG1667
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 313 1.000 Inparanoid score I2517
OMA 1 1.010
OrthoDB 1 1.010 D1163528at2759
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 1 1.000 T597318
orthoMCL 1 0.900 OOG5_129434
Panther 1 1.100 O PTHR12621
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.