DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and chordc1b

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_956633.1 Gene:chordc1b ZFINID:ZDB-GENE-040426-1288 Length:341 Species:Danio rerio

Alignment Length:345 Identity:149/346 (43%)
Similarity:224/346 (65%) Gaps:23/346 (7%)


  Fly     4 CYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVKP 68
            |||:||||.||.:.|:|::|.:|||.|.||||.||||||.:::.||::||:|.|||...|:..||
Zfish     5 CYNKGCGQRFDLEKNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIAGCTKGPHNQEKP 69

  Fly    69 PEPEKP-VKDESDKDEV--------IEVRAPIREALPRPPIDSPLTVIQPTVAPALKDMVFAVKT 124
            .||.|| ||...||::|        |:...|: |::.||..|.|.:::|..::|:||..:..:|.
Zfish    70 AEPVKPEVKSSLDKNDVKPKYDEFIIQAPKPL-ESIQRPSPDEPFSILQSKISPSLKQALEKLKL 133

  Fly   125 ------PAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQKRTS 183
                  ...::.||.|::||:|||.||..:|.|.:||...|.||.||||||||||:||||:::||
Zfish   134 TEENAHEIKEEDSDEIKIGTSCKNGGCCKTFAGQASDDETCLYHAGVPIFHEGMKYWSCCKRKTS 198

  Fly   184 DFSQFMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIRLH 248
            ||:.|::|:|||.|:|:|.|::..||||.||:|||||.:.|:::||||......|::|.|...|.
Zfish   199 DFNTFLSQEGCTRGKHQWKKKDAGKKVVPCRFDWHQTGSQVIISIYAKNSVPELSLVEGNSTVLK 263

  Fly   249 VNLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKKLPVVKKS 313
            ::::|  :....|:..:.|.|:::.|.:..:|..||:||.|.|.||.||:.|:     ||.|...
Zfish   264 IHIIF--EGEKEFEKQISLWGVIDPSKSLVNMMATKIEIVLKKAEPMSWARLD-----LPPVAPP 321

  Fly   314 QVEEKKKQEESDEEFFDLDD 333
            :.:||:|..:|::|..|.:|
Zfish   322 KEKEKEKDVDSEDECDDDED 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 34/59 (58%)
CHORD 138..199 CDD:282781 37/61 (61%)
p23_melusin_like 213..301 CDD:107238 33/88 (38%)
chordc1bNP_956633.1 CHORD 5..64 CDD:282781 34/59 (58%)
CHORD 153..214 CDD:282781 37/61 (61%)
p23_melusin_like 228..314 CDD:107238 33/88 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1667
Hieranoid 1 1.000
Homologene 1 1.000 H8111
Inparanoid 1 1.050 313 1.000 Inparanoid score I2517
OMA 1 1.010
OrthoDB 1 1.010 D1163528at2759
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 1 1.000 T597318
orthoMCL 1 0.900 OOG5_129434
Panther 1 1.100 LDO PTHR12621
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.