DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and Itgb1bp2

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001101715.1 Gene:Itgb1bp2 RGDID:1565015 Length:349 Species:Rattus norvegicus

Alignment Length:342 Identity:135/343 (39%)
Similarity:187/343 (55%) Gaps:24/343 (7%)


  Fly     4 CYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVKP 68
            |||:||||.|||.||..:|||:|||.|.||||.||||||.|::|||:|||||||||:..|...|.
  Rat     5 CYNKGCGQHFDPNTNLPDSCRYHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTVGPHCAEKL 69

  Fly    69 PE---PEKPVKDESDKDEVIEVRAPIREALPRPPIDSPLTVIQPTVAPALKDMVFAV-------- 122
            ||   ||.|......:.:.:.......|.|.|   :.|.:.:.|.:.|.|......|        
  Rat    70 PEVPQPEGPATSSLQEQKPLNTIPKSAETLLR---ERPKSEMPPKLLPLLISQALGVALEQKELD 131

  Fly   123 KTPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQKRTSDFSQ 187
            :.|.|...:..|..|::|:|.||...:.|..||...||||||.|.||||||.||||..:|.||..
  Rat   132 QEPGAGLDNSLIWTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGA 196

  Fly   188 FMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIRLHVNLV 252
            |:||.||..|.|.|.|:    ....||:|||||.:.||:.:|.:....:.:.::.:...|||::|
  Rat   197 FLAQPGCRVGRHDWAKQ----LPASCRHDWHQTDSLVVLTVYGQIPLPAFNWVKASQTELHVHIV 257

  Fly   253 FPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKKLPVVKKSQVEE 317
            |  ..|..|...::|.|::||..:|..:..::|||.|.|.:||||:.|..|:......:...:.|
  Rat   258 F--DGNRVFQAQMKLWGVINVEQSSVSLMPSRVEISLVKADPGSWAQLEHPDSLAEKARAGVLLE 320

  Fly   318 KKKQEESDEEFFDLDDI 334
            ..::|..|.:    ||:
  Rat   321 MDEEESEDSD----DDL 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 42/59 (71%)
CHORD 138..199 CDD:282781 33/61 (54%)
p23_melusin_like 213..301 CDD:107238 32/88 (36%)
Itgb1bp2NP_001101715.1 CHORD 3..64 CDD:282781 42/59 (71%)
CHORD 148..208 CDD:282781 33/60 (55%)
p23_melusin_like 218..304 CDD:107238 32/88 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C179615343
eggNOG 1 0.900 E1_KOG1667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1163528at2759
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 1 1.000 T618594
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12621
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
87.810

Return to query results.
Submit another query.