DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and CHORDC1

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_036256.2 Gene:CHORDC1 HGNCID:14525 Length:332 Species:Homo sapiens

Alignment Length:338 Identity:145/339 (43%)
Similarity:218/339 (64%) Gaps:26/339 (8%)


  Fly     4 CYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVKP 68
            ||||||||.|||:||:|::|.:|||.|.||||.||||||.:::.||::||:|.|||..:|::.||
Human     5 CYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKP 69

  Fly    69 PEPEKPVKDESDKDEVIEVRAPIR----------EALPRPPIDSPLTVIQPTVAPALKDMVFAVK 123
            |||.||....::|.|:.|::...:          ||:.||..|.|:|.::..::.:||..:..:|
Human    70 PEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLK 134

  Fly   124 TPAA------QKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQKRT 182
            ..:.      ::.:|.|::||:|||.||:.::.|..|....|.||.||||||||||:||||:::|
Human   135 LSSGNEENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKT 199

  Fly   183 SDFSQFMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIRL 247
            |||:.|:||:|||.|:|.|.|::..||||.||:|||||...|.:::|||......|.:|.|...|
Human   200 SDFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLL 264

  Fly   248 HVNLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKKLPVVKK 312
            :|::||  :....||.:::|.|:::|..:...|..||:||.:.|.||..|::|     :||..||
Human   265 NVHIVF--EGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASL-----ELPAAKK 322

  Fly   313 SQVEEKKKQEESD 325
               :||:|...:|
Human   323 ---QEKQKDATTD 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 37/59 (63%)
CHORD 138..199 CDD:282781 36/61 (59%)
p23_melusin_like 213..301 CDD:107238 33/88 (38%)
CHORDC1NP_036256.2 Interaction with PPP5C. {ECO:0000250} 2..77 45/72 (63%)
CHORD 3..64 CDD:309895 37/59 (63%)
Interaction with HSP90AA1 and HSP90AB1. {ECO:0000250} 65..316 99/258 (38%)
CHORD 155..216 CDD:309895 36/61 (59%)
p23_melusin_like 230..316 CDD:107238 33/93 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1667
Hieranoid 1 1.000
Homologene 1 1.000 H8111
Inparanoid 1 1.050 307 1.000 Inparanoid score I2593
Isobase 1 0.950 0 Normalized mean entropy S3736
OMA 1 1.010
OrthoDB 1 1.010 D1163528at2759
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 1 1.000 T609652
orthoMCL 1 0.900 OOG5_129434
Panther 1 1.100 LDO PTHR12621
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3238
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.