DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and Itgb1bp2

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_038740.1 Gene:Itgb1bp2 MGIID:1353420 Length:350 Species:Mus musculus

Alignment Length:343 Identity:135/344 (39%)
Similarity:188/344 (55%) Gaps:25/344 (7%)


  Fly     4 CYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVK- 67
            |||:||||.|||.||..:|||:|||.|.||||.||||||.|::|||:|||||||||:..|...| 
Mouse     5 CYNKGCGQHFDPNTNLPDSCRYHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTVGLHCAEKL 69

  Fly    68 ---PPEPEKPVKDESDKDEVIEVRAPIREALPRPPIDSPLTVIQPTVAPALKDMVFAV------- 122
               ||:||.|......:.:.:.......|.|.|   :.|.:.:.|.:.|.|......|       
Mouse    70 PEVPPQPEGPATSSLQEQKPLNTIPKSAETLFR---ERPKSEMPPKLLPLLISQALGVALEQKEL 131

  Fly   123 -KTPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQKRTSDFS 186
             :.|.|...:..|..|::|:|.||...:.|..||...||||||.|.||||||.||||..:|.||.
Mouse   132 DQEPGAGLDNSLIWTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFG 196

  Fly   187 QFMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIRLHVNL 251
            .|:||.||..|.|.|.|:    ....||:|||||.:.||:.:|.:....:.:.::.:...|||::
Mouse   197 AFLAQPGCRVGRHDWAKQ----LPASCRHDWHQTDSVVVLTVYGQIPLPAFNWVKASQTELHVHI 257

  Fly   252 VFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKKLPVVKKSQVE 316
            ||  ..|..|...::|.|::||..:|..:..::|||.|.|.:||||:.|..|:......:...:.
Mouse   258 VF--DGNRVFQAQMKLWGVINVEQSSVSLMPSRVEISLVKADPGSWAQLEHPDSLAEKARAGVLL 320

  Fly   317 EKKKQEESDEEFFDLDDI 334
            |..::|..|.:    ||:
Mouse   321 EMDEEESEDSD----DDL 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 42/59 (71%)
CHORD 138..199 CDD:282781 33/61 (54%)
p23_melusin_like 213..301 CDD:107238 32/88 (36%)
Itgb1bp2NP_038740.1 CHORD 3..64 CDD:282781 42/59 (71%)
SH3-binding. {ECO:0000255} 28..31 2/3 (67%)
SH3-binding. {ECO:0000255} 70..79 4/9 (44%)
CHORD 149..209 CDD:282781 33/60 (55%)
SH2-binding. {ECO:0000255} 159..162 1/3 (33%)
SH3-binding. {ECO:0000255} 173..176 2/3 (67%)
p23_melusin_like 219..305 CDD:107238 32/88 (36%)
SH2-binding. {ECO:0000255} 235..238 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C179615549
eggNOG 1 0.900 E1_KOG1667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1163528at2759
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 1 1.000 T616473
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12621
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.810

Return to query results.
Submit another query.