DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and ITGB1BP2

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_036410.1 Gene:ITGB1BP2 HGNCID:6154 Length:347 Species:Homo sapiens

Alignment Length:340 Identity:143/341 (42%)
Similarity:194/341 (57%) Gaps:23/341 (7%)


  Fly     4 CYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVKP 68
            |.|:||||.|||.||..:||.||||.|.||||.||||||.|::|||:|||||||||:..|...|.
Human     5 CRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKL 69

  Fly    69 PE---PEKPVKDES-DKDEVIEVRAPIREAL--PRPPIDSPLTVIQPTVAPALKDMVFAVK---- 123
            ||   ||.|....| .:.:.:.|.....|.|  .||..:.||.::...::.|| :|....|    
Human    70 PEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQAL-EMALEQKELDQ 133

  Fly   124 TPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQKRTSDFSQF 188
            .|.|...| .|..|::|:|.||...:.|..||...||||||.|.||||||.||||..:|.||..|
Human   134 EPGAGLDS-LIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAF 197

  Fly   189 MAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIRLHVNLVF 253
            :||.||..|.|.|.|:    ....||:|||||.:.||:.:|.:....:.:.::.:...|||::||
Human   198 LAQPGCRVGRHDWGKQ----LPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVF 258

  Fly   254 PEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKKLPVVKKSQ--VE 316
              ..|..|...::|.|::||..:|..:..::|||.|.|.:||||:.|..|:   .:.||::  |.
Human   259 --DGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPD---ALAKKARAGVV 318

  Fly   317 EKKKQEESDEEFFDL 331
            .:..:||||:...||
Human   319 LEMDEEESDDSDDDL 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 41/59 (69%)
CHORD 138..199 CDD:282781 33/61 (54%)
p23_melusin_like 213..301 CDD:107238 32/88 (36%)
ITGB1BP2NP_036410.1 CHORD 3..64 CDD:282781 41/59 (69%)
SH3-binding. {ECO:0000255} 28..31 2/3 (67%)
SH3-binding. {ECO:0000255} 70..78 4/8 (50%)
CHORD 148..208 CDD:282781 33/60 (55%)
SH2-binding. {ECO:0000255} 158..161 1/3 (33%)
SH3-binding. {ECO:0000255} 172..175 2/3 (67%)
p23_melusin_like 218..304 CDD:107238 32/88 (36%)
SH2-binding. {ECO:0000255} 234..237 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C179617156
eggNOG 1 0.900 E1_KOG1667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1163528at2759
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 1 1.000 T609652
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12621
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.