DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHORD and chp-1

Sequence 1:NP_651226.1 Gene:CHORD FlyBaseID:FBgn0029503 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_491519.1 Gene:chp-1 WormBaseID:WBGene00000502 Length:321 Species:Caenorhabditis elegans

Alignment Length:339 Identity:122/340 (36%)
Similarity:186/340 (55%) Gaps:40/340 (12%)


  Fly     3 QCYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCNKKSVDFTEFLNIKGCTLAKHSNVK 67
            |||::|||.||||:.|::|:|.:|||.|:||||||.|:||:|||.||..::|.||||..||||.|
 Worm     8 QCYHKGCGLLFDPKENDNEACTYHPGGPYFHDAYKIWTCCDKKSTDFGTWMNYKGCTRGKHSNEK 72

  Fly    68 PPE-----PEKPVKDESDKDEVI------EVRAPIREALPRPPIDSPLTV-IQPTVAPALKDMVF 120
            |.:     ..|.::.|.::|.::      ..:...::|..|  |:..|.| :.|....|::..:.
 Worm    73 PVDIVKVAAVKEIRPEKEEDVIVWKGLNKSGKLDSKDATKR--IEQNLNVEVTPGATAAIEKKLK 135

  Fly   121 AVKTPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQKRTSDF 185
            .: :.||| |:| |::|..|:||||:..|.| |.:...|.:|||..|||||||:||||.|:||:|
 Worm   136 EI-SEAAQ-SAD-IQIGAPCRNNGCSTEFDG-SKNKENCQHHPGAAIFHEGMKYWSCCNKKTSNF 196

  Fly   186 SQFMAQKGCTYGEHKWVKENDDKKVVQCRYDWHQTATNVVMAIYAKKY--DYSQSVIELNPIRLH 248
            ..|:.|.|||.||||:   .:::.|.:.|.||..:...|.:.:|.:..  :.:..|.:.:.:|:.
 Worm   197 GAFLEQVGCTSGEHKF---RNNEIVSKFREDWFSSNGFVTINVYCRGALPETANIVSDGHTVRVS 258

  Fly   249 VNLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNLNFPNKKLPVVKKS 313
            :...|   .||..|||.:|...|....:...:...||||.|.:.....|..|.|           
 Worm   259 MKHGF---GNASVDLDYDLWDEVIPEESRVVIGERKVEISLKQKHGTGWPRLKF----------- 309

  Fly   314 QVEEKKKQEESDEE 327
               :.:...::|||
 Worm   310 ---DPELDAKNDEE 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHORDNP_651226.1 CHORD 3..63 CDD:282781 37/60 (62%)
CHORD 138..199 CDD:282781 34/61 (56%)
p23_melusin_like 213..301 CDD:107238 22/90 (24%)
chp-1NP_491519.1 CHORD 7..68 CDD:282781 37/60 (62%)
CHORD 150..210 CDD:282781 34/61 (56%)
p23_CS_SGT1_like 224..307 CDD:107223 20/86 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C179612873
eggNOG 1 0.900 E1_KOG1667
Hieranoid 1 1.000
Homologene 1 1.000 H8111
Inparanoid 1 1.050 206 1.000 Inparanoid score I2389
Isobase 1 0.950 0 Normalized mean entropy S3736
OMA 1 1.010
OrthoDB 1 1.010 D1163528at2759
OrthoFinder 1 1.000 FOG0002103
OrthoInspector 1 1.000 T475160
orthoMCL 1 0.900 OOG5_129434
Panther 1 1.100 LDO PTHR12621
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3238
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.