DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6178 and PCS60

Sequence 1:NP_651221.1 Gene:CG6178 FlyBaseID:FBgn0039156 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_009781.3 Gene:PCS60 SGDID:S000000426 Length:543 Species:Saccharomyces cerevisiae

Alignment Length:500 Identity:137/500 (27%)
Similarity:241/500 (48%) Gaps:44/500 (9%)


  Fly    74 VKQNDVVGLSSENSVNFALAMFAGLAVGATV-APLNVTYSDREVDHAINLSKPKIIF----ASKI 133
            |.:.|.|.:|..|.:.|.:| |.|..:.|.: ||||..|.::|.:..:|..|.|.|.    .:|:
Yeast    59 VFRQDTVAISMRNGLEFIVA-FLGATMDAKIGAPLNPNYKEKEFNFYLNDLKSKAICVPKGTTKL 122

  Fly   134 TIDRVAKVASKNKFVKGIIALSGTSKKFKNIYDL-------KEL----MEDEKFKTQPDFTSPAA 187
            ....:.|.||  .|...|:.|:..:.:|:..||:       |.:    :.:.||........|..
Yeast   123 QSSEILKSAS--TFGCFIVELAFDATRFRVEYDIYSPEDNYKRVIYRSLNNAKFVNTNPVKFPGF 185

  Fly   188 NKDEDVSLIVCSSGTTGLPKGVQLTQMNLL-ATLDSQIQPTVIPMEEVTLLTVIPWFHAFGCL-T 250
            .:..||:||:.:||||..||.|.|..:|:: :||:......:.|::.  ...|:|.||..|.: .
Yeast   186 ARSSDVALILHTSGTTSTPKTVPLLHLNIVRSTLNIANTYKLTPLDR--SYVVMPLFHVHGLIGV 248

  Fly   251 LITTACVGARLVYLPKFEEKLFLSAIEKYRVMMAFMVPPLMVFLAKHPIVDKYDLSSLMVLLCGA 315
            |::|......:|....|..|||.....||.......||.:.:.:...|..:.:. ....:..|.:
Yeast   249 LLSTFRTQGSVVVPDGFHPKLFWDQFVKYNCNWFSCVPTISMIMLNMPKPNPFP-HIRFIRSCSS 312

  Fly   316 APLSRETEDQIKERIGVPFIRQGYGLSESTLSVLVQN--DEFCKPGSVGVLKVGIYAKVIDPDTG 378
            | |:..|..::::....| :.:.|.::|::..:...|  ....|||:||..: |:...::| |..
Yeast   313 A-LAPATFHKLEKEFNAP-VLEAYAMTEASHQMTSNNLPPGKRKPGTVGQPQ-GVTVVILD-DND 373

  Fly   379 KLLGANERGELCFKGDGIMKGYIGDTKSTQTAI--KDGWLHTGDIGYYDDDFEFFIVDRIKELIK 441
            .:|...:.||:..:|:.:..||..:.|:.:...  ::.:..|||.||:|.:....:..||||||.
Yeast   374 NVLPPGKVGEVSIRGENVTLGYANNPKANKENFTKRENYFRTGDQGYFDPEGFLVLTGRIKELIN 438

  Fly   442 YKGYQVPPAEIEALLLTNDKIKDAAVIGKPDEEAGELPLAFVVKQANVQLTENEVIQFVNDNAS- 505
            ..|.::.|.|::.::|::.||.:|...|.||:..|::..|.:|.:...::|..|::.|:..:.: 
Yeast   439 RGGEKISPIELDGIMLSHPKIDEAVAFGVPDDMYGQVVQAAIVLKKGEKMTYEELVNFLKKHLAS 503

  Fly   506 ---PAKRLRGGVIFVDEIPKNPSGKILRRILREMLKK---QKSKL 544
               |.|     |.|||::||..:|||.||::.|...|   .||||
Yeast   504 FKIPTK-----VYFVDKLPKTATGKIQRRVIAETFAKSSRNKSKL 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6178NP_651221.1 PLN02246 26..537 CDD:215137 132/489 (27%)
Firefly_Luc_like 43..529 CDD:213279 129/481 (27%)
PCS60NP_009781.3 FACL_fum10p_like 188..531 CDD:213292 97/355 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I915
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T634771
orthoMCL 1 0.900 OOG5_126609
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.