DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6178 and CG18586

Sequence 1:NP_651221.1 Gene:CG6178 FlyBaseID:FBgn0039156 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_647993.2 Gene:CG18586 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster

Alignment Length:532 Identity:143/533 (27%)
Similarity:246/533 (46%) Gaps:47/533 (9%)


  Fly    26 SLGQYILDKYKSFGDRT------VLVDAVNGVEYSASFMHKSIVRLAYILQKLGVKQNDVVGLSS 84
            |:|:.|      |||..      ..:.....:..:...:|.:.:|:|..::.:|:.|.|:||:..
  Fly    38 SIGEII------FGDMVNNPKLIAQISITEDIVLTREDLHMNAMRVASYMRNMGLGQTDIVGVMG 96

  Fly    85 ENSVNFALAMFAGLAVGATVAPLNVTYSDREVDHAINLSKPKIIFASKITIDRVAKVASKNKFVK 149
            .::.:.:...:|....|..:..|:..|.:..:.....::||::||...   |...||.|..|.::
  Fly    97 RHTTHQSAVAYACFFNGTPLHALHNAYEEACIAKLFGITKPRLIFCDG---DEYEKVKSATKDLQ 158

  Fly   150 -GIIALSGTSKKFKNIYDLKELMEDEKFKTQPDFTSPAANKD--EDVSLIVCSSGTTGLPKGVQL 211
             .|:.:....:....|.|:......:.|:       |...||  :....|:.||||:|.||.|.:
  Fly   159 VTIVTMRNHPRGSVRIQDVLTTPVMQNFQ-------PLRLKDGIDHTLAILSSSGTSGFPKAVTI 216

  Fly   212 TQ-----MNLLATLDSQIQPTVIPMEEVTLLTVIPWFHAFGCLTLITTACVGARLVYLPKFEEKL 271
            :.     ::.:|..:|.||.|...::..:.|::......|...::|...          .|:..|
  Fly   217 SNSHKIIVDYMAINNSNIQYTSSTLDWCSGLSMAITSGVFSTTSIIADC----------DFDPGL 271

  Fly   272 FLSAIEKYRVMMAFMVPPLMVFLAKHPIVDKYDLSSLMVLLCGAAPLSRETEDQIKERIGVPFIR 336
            |..||.|||:.|..:....:...|..|..:..|||||..::.|.:..|.|.:.:::.|:....:.
  Fly   272 FCRAIGKYRISMVLLSSSYLAIFANCPEFESADLSSLNYVIFGGSSCSLEVQRKVRSRLSHDCLN 336

  Fly   337 QGYGLSE--STLSVLVQNDEFCKPGSVGVLKVGIYAKVIDPDTGKLLGANERGELCFKGDGIMKG 399
            ..|||:|  |..||.:..||  ||.|||....||..|||| :.|:....|..||:||.......|
  Fly   337 FCYGLTELNSAGSVNLNFDE--KPNSVGRAIRGIKIKVID-EQGEAQEPNVVGEICFHNSQKWAG 398

  Fly   400 YIGDTKST-QTAIKDGWLHTGDIGYYDDDFEFFIVDRIKELIKYKGYQVPPAEIEALLLTNDKIK 463
            |..:...| |....:.|:||||:||.|.|...|::||:|:::||:.....|:|||.::.....:.
  Fly   399 YYKNPDETRQIQDSENWIHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVL 463

  Fly   464 DAAVIGKPDEEAGELPLAFVVKQANVQLTENEVIQFVNDN-ASPAKRLRGGVIFVDEIPKNPSGK 527
            :|.|.|..|...|:...|.:||:...||...:|:::|... .:..|:|.||.:.||:|.::.:.|
  Fly   464 EACVFGIWDPVNGDEAAASLVKKPGTQLEAQDVVEYVRKRITAKFKQLNGGALIVDQIVRSGNRK 528

  Fly   528 ILRRILREMLKK 539
            ..|..::|...|
  Fly   529 TNRSAVKEHFLK 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6178NP_651221.1 PLN02246 26..537 CDD:215137 142/529 (27%)
Firefly_Luc_like 43..529 CDD:213279 134/498 (27%)
CG18586NP_647993.2 CaiC 35..541 CDD:223395 143/533 (27%)
AFD_class_I 55..530 CDD:302604 134/498 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.