| Sequence 1: | NP_651221.1 | Gene: | CG6178 / 42867 | FlyBaseID: | FBgn0039156 | Length: | 544 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_647993.2 | Gene: | CG18586 / 38659 | FlyBaseID: | FBgn0035642 | Length: | 545 | Species: | Drosophila melanogaster | 
| Alignment Length: | 532 | Identity: | 143/532 - (26%) | 
|---|---|---|---|
| Similarity: | 246/532 - (46%) | Gaps: | 47/532 - (8%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    26 SLGQYILDKYKSFGDRT------VLVDAVNGVEYSASFMHKSIVRLAYILQKLGVKQNDVVGLSS 84 
  Fly    85 ENSVNFALAMFAGLAVGATVAPLNVTYSDREVDHAINLSKPKIIFASKITIDRVAKVASKNKFVK 149 
  Fly   150 -GIIALSGTSKKFKNIYDLKELMEDEKFKTQPDFTSPAANKD--EDVSLIVCSSGTTGLPKGVQL 211 
  Fly   212 TQ-----MNLLATLDSQIQPTVIPMEEVTLLTVIPWFHAFGCLTLITTACVGARLVYLPKFEEKL 271 
  Fly   272 FLSAIEKYRVMMAFMVPPLMVFLAKHPIVDKYDLSSLMVLLCGAAPLSRETEDQIKERIGVPFIR 336 
  Fly   337 QGYGLSE--STLSVLVQNDEFCKPGSVGVLKVGIYAKVIDPDTGKLLGANERGELCFKGDGIMKG 399 
  Fly   400 YIGDTKST-QTAIKDGWLHTGDIGYYDDDFEFFIVDRIKELIKYKGYQVPPAEIEALLLTNDKIK 463 
  Fly   464 DAAVIGKPDEEAGELPLAFVVKQANVQLTENEVIQFVNDN-ASPAKRLRGGVIFVDEIPKNPSGK 527 
  Fly   528 ILRRILREMLKK 539 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG6178 | NP_651221.1 | PLN02246 | 26..537 | CDD:215137 | 142/528 (27%) | 
| Firefly_Luc_like | 43..529 | CDD:213279 | 134/497 (27%) | ||
| CG18586 | NP_647993.2 | CaiC | 35..541 | CDD:223395 | 143/532 (27%) | 
| AFD_class_I | 55..530 | CDD:302604 | 134/497 (27%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0318 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D683933at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24096 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.920 | |||||