DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6178 and CG5568

Sequence 1:NP_651221.1 Gene:CG6178 FlyBaseID:FBgn0039156 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_647992.1 Gene:CG5568 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster

Alignment Length:539 Identity:144/540 (27%)
Similarity:240/540 (44%) Gaps:58/540 (11%)


  Fly    26 SLGQYILDKYKSFGDRTVLVDAVNGVEYSASFMHKSIVRLAYILQKLGVKQNDVVGLSSENSVNF 90
            |:|:.|..:.:.....|..:......|.:...:..:.:::|..::|||::|.|.||:....:.:.
  Fly    38 SIGEIIFQQMERNAMLTAQISVTENTELTWKDIQTNAMKVASYMRKLGLEQGDFVGVIGRLTTHL 102

  Fly    91 ALAMFAGLAVGATVAPLNVTYSDREVDHAINLSKPKIIFASKITIDRVAKVASKNKFVKGIIALS 155
            ....:|....|.....|:..|....::....::||::||......::| :.|:|...|: |:.:.
  Fly   103 TALAYACFFNGTPYHALHTEYEQSAIERLFGITKPRLIFCDGDEFEKV-QAATKGLQVQ-IVTMR 165

  Fly   156 GTSKKFKNIYDLKELMEDEKFKTQPDFTSPAANKD--EDVSLIVCSSGTTGLPKGVQLTQMNLL- 217
            ........|.|:.....:..|:       |...||  :.:..|:.||||:||||.|.::..:.: 
  Fly   166 NHPAGILRIQDILTTPVEMNFR-------PVRLKDGTDQLLAILSSSGTSGLPKAVTISNSHQII 223

  Fly   218 ---ATLDS---QIQPTVIPMEEVTLLTVIPWFHAFGCLTLITTACVGARLVYLPKFEEKLFLSAI 276
               ..:||   |..|..:.......:|:..   |...||.|...|         .|:.......|
  Fly   224 GSFLPVDSSIIQYNPNTLDWASGITMTINA---AVFSLTSIIEDC---------DFDPANLCGLI 276

  Fly   277 EKYRVMMAFMVPPLMVFLAKHPIVDKYDLSSLMVLLCGAAPLSRETEDQIKERIGVPFIRQGYGL 341
            ||||:.|.|:....:..|:..|.....||||:.....|.:..|.|.:::|:.|:....:...|.|
  Fly   277 EKYRISMVFVSSSQLAMLSNCPEFYAADLSSVKYFFYGGSNCSLEVQNKIRSRLSNECVNFSYTL 341

  Fly   342 SESTLSVLVQNDEFC-------KPGSVGVLKVGIYAKVIDPDTGKLLGANERGELCFKGDGIMKG 399
            :|       .|...|       ||.|||....||..|::: :.|:..|.|..||:||.......|
  Fly   342 TE-------LNSPGCLNFNFDEKPNSVGRPVRGIQIKIVN-ELGEAQGPNVVGEICFNNGQKWPG 398

  Fly   400 YI---GDTKSTQTAIKDGWLHTGDIGYYDDDFEFFIVDRIKELIKYKGYQVPPAEIEALLLTNDK 461
            |.   .:||..|.:  :.|.||||:||.|:|...||:||:|:::||:.....|:|||:::.....
  Fly   399 YYKNPEETKKMQDS--ENWFHTGDLGYMDEDGYLFIIDRLKDMLKYQTIMYYPSEIESVIAEMPN 461

  Fly   462 IKDAAVIGKPDEEAGELPLAFVVKQANVQLTENEVIQFVNDNASPA--KRLRGGVIFVDEIPKNP 524
            :.:|.|.|..|...|:...|.|||:...||...:|:::|.... ||  |:|.||.:.||.|.::.
  Fly   462 VVEACVFGIWDPVYGDKAAASVVKKQGTQLEAQDVVEYVRKRI-PAKFKQLNGGALIVDHIIQSG 525

  Fly   525 SGKILR-----RILREMLK 538
            :.|..|     ..||.|.|
  Fly   526 NRKANRAATKAEFLRIMEK 544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6178NP_651221.1 PLN02246 26..537 CDD:215137 143/537 (27%)
Firefly_Luc_like 43..529 CDD:213279 135/507 (27%)
CG5568NP_647992.1 CaiC 35..540 CDD:223395 141/534 (26%)
Firefly_Luc_like 55..530 CDD:213279 135/507 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.