DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6178 and C32E8.6

Sequence 1:NP_651221.1 Gene:CG6178 FlyBaseID:FBgn0039156 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_740831.1 Gene:C32E8.6 WormBaseID:WBGene00016324 Length:461 Species:Caenorhabditis elegans

Alignment Length:546 Identity:148/547 (27%)
Similarity:242/547 (44%) Gaps:125/547 (23%)


  Fly    25 RSLGQYILDKYKSFGDRTVLV--DAVNGVEYSASFMHKSIVRLAYILQKLGVKQNDV--VGLSSE 85
            |:.|:..|::...|.::|.|:  |.    |.|....|:.|.:...:|.:...|..:.  :.|...
 Worm     3 RNFGREFLEETSIFENKTCLIWRDR----EISFKEFHEYIGKWKNVLDEQKTKTTNPLRIALFCT 63

  Fly    86 NSVNFALAMFAGLAVGATVAPLNVTYSDREVDHAINLSKPK-IIFASKITIDRVAKVASKNKFVK 149
            ||.:....:.||...|.||.|||.:|...|:|..|:.|... ||.:..:.:|:            
 Worm    64 NSPDILAIIVAGQLSGVTVIPLNPSYKKYEIDEYISKSIANFIIVSDDVDLDK------------ 116

  Fly   150 GIIALSGTSKKFKNIYDLKEL-MEDEKFKTQPDFTSPAANKDEDVSLIVCSSGTTGLPKGVQLTQ 213
                           ::.:|: :..|.|.:....:|.|:..:....::..||||||.||..:.||
 Worm   117 ---------------FEEREVNLISELFTSNVTPSSTASTPENQGVIVFFSSGTTGPPKQFEYTQ 166

  Fly   214 MNLLATLDSQIQ-----PTVI-PMEEVTLLTVIPWFHAFGCLTLITTACVGARLVYLPKFEEKLF 272
            ..|.:.:| ||:     |... |..:.....|:|:|||.|.:|:::....|..::...::.|..|
 Worm   167 RILCSQID-QIKAIRSDPRFFSPSTDDICYGVLPFFHAGGLITILSMIFSGCTVLINERWNEHEF 230

  Fly   273 LSAIEKYRVMMAFMVPPLMVFLAKHPIVDKYDLSSLMVLLCGAAPLSRETEDQIKERIGVPFIR- 336
            |:..:.|:|.:.|:|||::.|.|.||:|..||||:|..:..|||....|...::.||:  |.:. 
 Worm   231 LANCQNYKVSVLFLVPPVLNFFANHPLVSSYDLSALKTIYVGAAASPPENFAKVAERL--PELEN 293

  Fly   337 --QGYGLSESTLSVLVQNDEFCKPGSVGVLKVGIYAKVIDPDTGKLLG----------ANERGEL 389
              |.||.||  ..||:     |..|.             ...:||.:|          ..|..|:
 Worm   294 LIQLYGTSE--CGVLL-----CSTGK-------------GKASGKTVGWPFPFVELKINPENNEI 338

  Fly   390 CFKGDGIMKGYIGDTKSTQTAIKDGWLHTGDIGYYD-DDFEFFIVDRIKELIKYKGYQVPPAEIE 453
            ..|              :.||:::|::.|||:|... ...|..||.|.||::|.:|:||.|.|:|
 Worm   339 FVK--------------SATAMEEGFMETGDLGCLSFKTIELMIVGRSKEMMKIRGWQVNPNEVE 389

  Fly   454 ALLLTNDKIKDAAV-----------IGKPDEEAGELPLAFVVKQANVQLTENEVIQFVNDNASPA 507
            .::...:.:.|.||           ||.||.:|                   ::.:.|.||.:..
 Worm   390 DVIRKVEGVLDCAVYQNQEKLTAKIIGNPDSKA-------------------DIFKIVKDNLASY 435

  Fly   508 KRLRGGVIFVDEIPKNPSGKILRRIL 533
            |:| ..||||:|:|:|||||::|.:|
 Worm   436 KQL-DDVIFVEELPRNPSGKLVRHML 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6178NP_651221.1 PLN02246 26..537 CDD:215137 147/546 (27%)
Firefly_Luc_like 43..529 CDD:213279 141/523 (27%)
C32E8.6NP_740831.1 CaiC 8..457 CDD:223395 144/537 (27%)
AFD_class_I 57..455 CDD:302604 133/482 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.