DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx1A and Syx7

Sequence 1:NP_001189276.1 Gene:Syx1A FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_730632.1 Gene:Syx7 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster

Alignment Length:274 Identity:67/275 (24%)
Similarity:121/275 (44%) Gaps:35/275 (13%)


  Fly    35 DFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQELEDLM-------ADIKKNANRV 92
            ||....:.|...|.|||.||..:::..:. |:.||...:.|::|..:|       .|.....|.|
  Fly    22 DFQRLAQIIATSIQKVQQNVSTMQRMVNQ-LNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINEV 85

  Fly    93 RGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLE 157
             .|.|.....|:::...::.:|.|    |...::.||..::      .:|..|: .:|.......
  Fly    86 -DKCKERHLKIQRDRLVDEFTAAL----TAFQSVQRKTADI------EKTALRQ-ARGDSYNIAR 138

  Fly   158 ITGRPTNDDELEKMLEEGNSSVFTQGII--------METQQAKQT-LADIEARHQDIMKLETSIK 213
            ..|............::.|:|.|.....        |:||..:|. |..:|.:.|.|.:||.:|.
  Fly   139 PPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEEQADLQALEEQEQVIRELENNIV 203

  Fly   214 ELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILICLTVL 278
            .:::::..:..||..||..:|.||..||....:|...|::.:||..|::|.|:||:::      :
  Fly   204 GVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLIL------V 262

  Fly   279 GILAASYVSSYFII 292
            |||:|..::...|:
  Fly   263 GILSAVLLAIILIL 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:307101 47/211 (22%)
SNARE 231..281 CDD:310388 16/50 (32%)
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 25/108 (23%)
COG5325 <97..276 CDD:227635 46/196 (23%)
SNARE 188..247 CDD:304603 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2593160
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19957
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.