DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SMC1 and smc1b

Sequence 1:NP_651211.2 Gene:SMC1 FlyBaseID:FBgn0040283 Length:1238 Species:Drosophila melanogaster
Sequence 2:XP_009296271.1 Gene:smc1b ZFINID:ZDB-GENE-091217-1 Length:1235 Species:Danio rerio

Alignment Length:1228 Identity:466/1229 (38%)
Similarity:750/1229 (61%) Gaps:27/1229 (2%)


  Fly    26 FLEYIEMENFKSYRGHIVVGPLKQFNAVIGPNGSGKSNFMDAISFVMGEKTSSLRVKRLNDLIHG 90
            ||:.:::|||||:||...:||.|:||.:||.|||||||.|||:.|||||:.::||||...|||||
Zfish     3 FLKQLDVENFKSWRGKQTIGPFKRFNCIIGTNGSGKSNVMDALGFVMGERAANLRVKHTRDLIHG 67

  Fly    91 SSIGKPVSRSCYVTAKFVLNEERHMDFQRAVIGGSSEYRINGESVSSSTYLNKLEKIGINVKAKN 155
            :.||.|||....||..:..:.:..|.|.|.:.|.||||.:||:.|:.:.|..:|:||||.|||||
Zfish    68 AHIGNPVSTFASVTMIYCGDNDEEMTFSRRISGESSEYLVNGKHVTLAKYTGELQKIGIVVKAKN 132

  Fly   156 FLVFQGAVENIAMKTPKERTALFEEISGSGLLKDDYNRLKQEMIVAEEETQFTYQKKKGIAAERK 220
            .||:|||||:|||...||||.:||.|||||.|..:|......:..|:|:|||.:.:||...||:|
Zfish   133 CLVYQGAVESIAMMNAKERTKMFERISGSGDLNIEYFTKLAVLQKAKEDTQFHFNRKKAATAEKK 197

  Fly   221 EAKHEKMEADRYTRLQNEYNEKQVEYQLFRLFHVERDIRKFTSDLEVRQQEVKAVEQRK---EAA 282
            :...:|.||.||..|.::..|.:::..||:|||.|:.|...::.|...|   .|..|:|   :|.
Zfish   198 QVFKDKTEAQRYQSLVDDLRECKLQLTLFQLFHNEKSIDAQSASLGDMQ---AAAAQQKISLDAW 259

  Fly   283 DEILREKKKDAGKITRDLAKIDQEIREFETQMNKRRPLYIKAKEKVTHCKKKLISLQKTLETARE 347
            ::.::.:||:.|::.|:|.::::|||..|..:|::||.|||||...:|.::|:....::|:..:.
Zfish   260 EQTVKTQKKEHGRLNRELQQLEKEIRSQEQILNQQRPQYIKAKVNTSHHEQKVQEAHRSLQKNQN 324

  Fly   348 ADNAHQSDIRKLEKQLADVEALKKRFEDEIENESQRRGKSVNMEEGLVQEYDRLKQEAEATATQY 412
            .......::.:|:::|.::|...|..|.::|.|..|||..|.::|..::.|..||:.|.......
Zfish   325 LQAKKGQELEELKRELTELERAWKTSERQMEEEEARRGAGVQLQESQLERYKELKELARRNGAIL 389

  Fly   413 RSELDSVNREQKSEQDTLDGETNRRASVEESFKKLTLQREEAVKRRDKLMDHIKSSQAALEEQNR 477
            ....:.::.|.|::::.|..:..|::.::.:.|......|:..:|.:||.:::.::...||||.:
Zfish   390 NQSAEKLHWEVKADREKLQFDLRRKSEIQGNIKHSQTHLEDISRRAEKLEEYVNTTTQTLEEQRQ 454

  Fly   478 IKDELRRDVGTSKEKIAEKQRELEDVRDQLGDAKSDKHEDARRKKKQEVVELFKKQVPG-VYDRM 541
            .:::|..::.....::.|...||..|..:|.:|:.|..|:.|::|:.||:|..::..|. ||.|:
Zfish   455 QEEQLSEELAKGLVRMEEVNVELAQVLTKLQNARLDSQENRRQQKRDEVLESLRRLYPDTVYGRL 519

  Fly   542 INMCQPTHKRYNVAVTKVLGKFMEAIIVDTEKTARHCIQILKEQMLEVETFLPLDYLQVKPLKER 606
            :.:|||.||:|.:|||||.||.|.||:|.:...|..||:.|||:..|.|||||:||:.|..|.||
Zfish   520 VELCQPIHKKYQLAVTKVFGKNMNAIVVTSAYVAHDCIRYLKEERAEPETFLPIDYIDVPILNER 584

  Fly   607 LRNISDPRNVRLVFDVLKFE---PQEIERAVLFATGNALVCETPEDAMKVAYEIDRSRFDALALD 668
            ||.:   :..::|.||::..   || ::|.:.:..||:|||||.:||.::|:: ...|...:|||
Zfish   585 LREV---QGAKMVVDVVQCSQNAPQ-LKRVIQYVCGNSLVCETLKDARRIAFD-GPERLQTVALD 644

  Fly   669 GTFYQKSGLISGGSHDLARKAKRWDEKHMAQLKMQKERLQEELKELVKKSRKQSELATVESQIKG 733
            ||.::|||:|||||.||::||:||:||.|.:||.:|::|..|::.|:|..||:.:|..:.:|.:|
Zfish   645 GTLFRKSGVISGGSSDLSKKARRWEEKDMNKLKEEKDKLSSEMRALMKLKRKEVDLKQIRAQSQG 709

  Fly   734 LENRLKYSMVDLES-SKKSISQYDNQLQQVQSQLDEFGPKILEIER-RMQNREEHIQEIKENMNN 796
            .:.||||:..:|:| .||||.....::.:::|:|.....:| ||:. .::.::..::.:|:.::.
Zfish   710 NQTRLKYANTELDSIRKKSIPAAQIEISKLRSELSNLEAQI-EIQTGNLELKDSEMKAVKDKIHQ 773

  Fly   797 VEDKVYASFCRRLGVKNIRQYEERELVMQQERARKRAEFEQQIDSINSQLDFEKQKDTK--KNVE 859
            :||.|:|.||..:||.|||:||:..|.:|||..:||.:||.|...:::||::|:.:..|  |.::
Zfish   774 MEDLVFADFCAEIGVANIREYEQDYLRLQQELEKKRLQFESQQTRLSTQLEYEQAQLEKLVKLMK 838

  Fly   860 RWERSVQDEEDALEGLKLAEARYLKEIDEDKEKMEKFKQDKQAKKQAVDDMEEDISKARKDVANL 924
            :.|.:::.|::.:..||..|...|..:::.:..:.|.......|...|::.:.::.||...:...
Zfish   839 KIEETIEKEKNIIISLKEGEDNILIAVEQTQSNLLKLNNQHSEKTHLVNNAKTELDKALTGLQER 903

  Fly   925 AKEIHNVGSHLSAVESKIEAKKNERQNILLQAKTDCIVVPLLRGSLDDAVRQSDPDVPSTSAAME 989
            .|.:..:.....:.::.:|..:..:.|:||..|.|.:.:.|:.|:|||..........|.|.:..
Zfish   904 NKVLMKLQKQTISTDAALEHLRLTKHNLLLTCKIDGLPLTLISGALDDISEIQVQTEESQSVSTL 968

  Fly   990 NIIE------VDYSSLPREYTKLKDDSAFKKTHEMLQKDLQSKLDVLERIQTPNMKALQKLDAVT 1048
            :|.|      .|:|:|......|.::|..:...|.|::.:.|...::...:.||:|||:|:..|.
Zfish   969 DIFEREAQMVFDFSALDNSLKMLTEESEVEAMLEKLKEGVSSLESMIMMSRAPNLKALEKIREVK 1033

  Fly  1049 EKVQSTNEEFENARKKAKRAKAAFERVKNERSSRFVACCQHISDAIDGIYKKLARNEAAQAYIGP 1113
            :..:...:.|:.:....|:....||:||.:|...|..|.:|:|..||.|||||.||.:|||.:..
Zfish  1034 DSYREVLDAFDISTITTKKRNQEFEQVKAKRFHLFSQCFEHVSVVIDQIYKKLCRNASAQAILSA 1098

  Fly  1114 DNPEEPYLDGINYNCVAPGKRFQPMNNLSGGEKTIAALALLFSTHSFHPAPFFVLDEIDAALDNT 1178
            :||.||||||||||||||||||..|:|||||||.||||||:|:.|||.|||||||||:|||||||
Zfish  1099 ENPNEPYLDGINYNCVAPGKRFMAMDNLSGGEKAIAALALVFAIHSFRPAPFFVLDEVDAALDNT 1163

  Fly  1179 NIGKVASYIRDHT-TNLQTIVISLKEEFYGHADALVGITPGEGDCLVSNVYIMDLTTF 1235
            |||||..:.|..: .:.|.||||||||||..||||:|:.....:|:.|.:..:|||.:
Zfish  1164 NIGKVTGFFRMMSRESCQIIVISLKEEFYSRADALLGVYSMFDECMFSRLLTLDLTPY 1221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SMC1NP_651211.2 Smc 26..1216 CDD:224117 461/1208 (38%)
ABC_SMC1_euk 27..>171 CDD:213242 78/144 (54%)
SMC_hinge 535..653 CDD:214944 56/122 (46%)
DUF4700 <697..>810 CDD:292399 35/115 (30%)
ABC_SMC1_euk <1130..1232 CDD:213242 65/103 (63%)
smc1bXP_009296271.1 Smc 3..1221 CDD:224117 466/1227 (38%)
ABC_SMC1_euk 4..>148 CDD:213242 78/144 (54%)
SMC_hinge 515..630 CDD:214944 55/119 (46%)
P-loop_NTPase <1115..1218 CDD:304359 65/103 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D326079at2759
OrthoFinder 1 1.000 FOG0001472
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127449
Panther 1 1.100 O PTHR18937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.