DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SMC1 and SMC1B

Sequence 1:NP_651211.2 Gene:SMC1 FlyBaseID:FBgn0040283 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_683515.4 Gene:SMC1B HGNCID:11112 Length:1235 Species:Homo sapiens

Alignment Length:1229 Identity:509/1230 (41%)
Similarity:779/1230 (63%) Gaps:23/1230 (2%)


  Fly    25 AFLEYIEMENFKSYRGHIVVGPLKQFNAVIGPNGSGKSNFMDAISFVMGEKTSSLRVKRLNDLIH 89
            |.||.:.:|||||:||..|:||.::|..:||||||||||.|||:|||||||.::||||.:.:|||
Human     2 AHLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKNIQELIH 66

  Fly    90 GSSIGKPVSRSCYVTAKFVLNEERHMDFQRAVIGGSSEYRINGESVSSSTYLNKLEKIGINVKAK 154
            |:.||||:|.|..|...:|........|.|.:.||.||:|.|...||.|.|:.:||||||.|||:
Human    67 GAHIGKPISSSASVKIIYVEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAELEKIGIIVKAQ 131

  Fly   155 NFLVFQGAVENIAMKTPKERTALFEEISGSGLLKDDYNRLKQEMIVAEEETQFTYQKKKGIAAER 219
            |.|||||.||:|::|.|||||..|||||.||.|..:|...|:::..|||:.||.:.|||.|||||
Human   132 NCLVFQGTVESISVKKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAER 196

  Fly   220 KEAKHEKMEADRYTRLQNEYNEKQVEYQLFRLFHVERDIRKFTSDLEVRQQEVKAVEQRKEAADE 284
            ::||.||.||:||..|..|....:::.|||:|:|.|:.|....:.||...:::....:.....:.
Human   197 RQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLSHHEN 261

  Fly   285 ILREKKKDAGKITRDLAKIDQEIREFETQMNKRRPLYIKAKEKVTHCKKKLISLQKTLETAREAD 349
            |::.:||:.|.:||.|.:.::|::..||.:|::||.||||||..:|..|||...:|:::.:.:..
Human   262 IVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKKLDVAKKSIKDSEKQC 326

  Fly   350 NAHQSDIRKLEKQLADVEALKKRFEDEIENESQRRGKSVNMEEGLVQEYDRLKQEAE---ATATQ 411
            :..:.||:.||.:|||::|..:.||.:||.|...:.:.:.:|...:..|..||::..   ||.||
Human   327 SKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQ 391

  Fly   412 YRSELDSVNREQKSEQDTLDGETNRRASVEESFKKLTLQREEAVKRRDKLMDHIKSSQAALEEQN 476
               :|:.:..|||::::.|..|..|...|:.:.|::..|.|:..||.:||.::.|:....|:|:.
Human   392 ---QLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKK 453

  Fly   477 RIKDELRRDVGTSKEKIAEKQRELEDVRDQLGDAKSDKHEDARRKKKQEVVELFKKQVP-GVYDR 540
            :.::.|..::..:|.:::|...||..:|.:|.:|..|.||..|::|:.||:|..|:..| .|:.|
Human   454 QQEETLVDEIEKTKSRMSEVNEELNLIRSELQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSVFGR 518

  Fly   541 MINMCQPTHKRYNVAVTKVLGKFMEAIIVDTEKTARHCIQILKEQMLEVETFLPLDYLQVKPLKE 605
            :.::|.|.||:|.:|||||.|:|:.||:|.:||.|:.||:.|||:..|.||||.||||.:||:.|
Human   519 LFDLCHPIHKKYQLAVTKVFGRFITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINE 583

  Fly   606 RLRNISDPRNVRLVFDVLKFEPQEIERAVLFATGNALVCETPEDAMKVAYEIDRSRFDALALDGT 670
            |||.:   :..::|.||:|.:..::::.:.|..||.|||||.|:|..:|.. ...|...:|||||
Human   584 RLREL---KGCKMVIDVIKTQFPQLKKVIQFVCGNGLVCETMEEARHIALS-GPERQKTVALDGT 644

  Fly   671 FYQKSGLISGGSHDLARKAKRWDEKHMAQLKMQKERLQEELKELVKKSRKQSELATVESQIKGLE 735
            .:.|||:|||||.||..||:.||||.:..|:.::.:..:|||.|:|..||:::|..:::.|:|.:
Human   645 LFLKSGVISGGSSDLKYKARCWDEKELKNLRDRRSQKIQELKGLMKTLRKETDLKQIQTLIQGTQ 709

  Fly   736 NRLKYSMVDLESSKKS--ISQYDNQLQQVQSQLDEFGPKILEIERRMQNREEHIQEIKENMNNVE 798
            .|||||..:||..||.  ::.|..| .|:||:|.....:.:.:...::.|:..|:|.:|.::.||
Human   710 TRLKYSQNELEMIKKKHLVAFYQEQ-SQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVE 773

  Fly   799 DKVYASFCRRLGVKNIRQYEERELVMQQERARKRAEFEQQIDSINSQLDFEKQKDTKK--NVERW 861
            |.::..||..:||:|||::|.:.:..|||..:||.|||:|...:|.||::.:....||  .:...
Human   774 DDIFQHFCEEIGVENIREFENKHVKRQQEIDQKRLEFEKQKTRLNVQLEYSRSHLKKKLNKINTL 838

  Fly   862 ERSVQDEEDALEGLKLAEARYLKEIDEDKEKMEKFKQDKQAKKQAVDDMEEDISKARKDVANLAK 926
            :.::|...:.::.||.||...|:.::|...|.::.|..:..:..:.:.::..|.:.||....:.:
Human   839 KETIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLKDIRVTQNSSAEKVQTQIEEERKKFLAVDR 903

  Fly   927 EIHNVGSHLSAVESKIEAKKNERQNILLQAKTDCIVVPLLRGSLDDAVR-QSDPDVPSTSAAM-- 988
            |:..:...:.::::.:|.|:.|:.|:||..|...|.:.||.|||||.:. :...:..||.|.:  
Human   904 EVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGSLDDIIEVEMGTEAESTQATIDI 968

  Fly   989 ---ENIIEVDYSSLPREYTKLKDDSAFKKTHEMLQKDLQSKLDVLERIQTPNMKALQKLDAVTEK 1050
               |...|:|||||..:...|:.|...:....:|.:.:.|:.|:|.:...||::||:.|..|.:|
Human   969 YEKEEAFEIDYSSLKEDLKALQSDQEIEAHLRLLLQQVASQEDILLKTAAPNLRALENLKTVRDK 1033

  Fly  1051 VQSTNEEFENARKKAKRAKAAFERVKNERSSRFVACCQHISDAIDGIYKKLARNEAAQAYIGPDN 1115
            .|.:.:.||.:||:|:..:..||:||..|...|..|.:|:|.:||.|||||.||.:|||::.|:|
Human  1034 FQESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQIYKKLCRNNSAQAFLSPEN 1098

  Fly  1116 PEEPYLDGINYNCVAPGKRFQPMNNLSGGEKTIAALALLFSTHSFHPAPFFVLDEIDAALDNTNI 1180
            ||||||:||:||||||||||.||:|||||||.:|||||||:.|||.|||||||||:|||||||||
Human  1099 PEEPYLEGISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNI 1163

  Fly  1181 GKVASYIRDHTTN-LQTIVISLKEEFYGHADALVGITPGEGDCLVSNVYIMDLTTFEDT 1238
            |||:|||::.|.: .|.||||||||||..||||:||.|...||:.|.|..:||:.:.||
Human  1164 GKVSSYIKEQTQDQFQMIVISLKEEFYSRADALIGIYPEYDDCMFSRVLTLDLSQYPDT 1222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SMC1NP_651211.2 Smc 26..1216 CDD:224117 499/1205 (41%)
ABC_SMC1_euk 27..>171 CDD:213242 80/144 (56%)
SMC_hinge 535..653 CDD:214944 55/119 (46%)
DUF4700 <697..>810 CDD:292399 35/115 (30%)
ABC_SMC1_euk <1130..1232 CDD:213242 73/103 (71%)
SMC1BNP_683515.4 Smc 3..1219 CDD:224117 506/1224 (41%)
ABC_SMC1_euk 4..>148 CDD:213242 80/144 (56%)
DUF342 <421..492 CDD:302792 19/71 (27%)
SMC_hinge 513..628 CDD:214944 54/118 (46%)
ABC_SMC1_euk <1113..1216 CDD:213242 73/103 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1196
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1178 1.000 Inparanoid score I195
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D326079at2759
OrthoFinder 1 1.000 FOG0001472
OrthoInspector 1 1.000 T609657
orthoMCL 1 0.900 OOG5_127449
Panther 1 1.100 O PTHR18937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.