DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SMC1 and smcl-1

Sequence 1:NP_651211.2 Gene:SMC1 FlyBaseID:FBgn0040283 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_509956.2 Gene:smcl-1 WormBaseID:WBGene00008085 Length:537 Species:Caenorhabditis elegans

Alignment Length:460 Identity:111/461 (24%)
Similarity:203/461 (44%) Gaps:84/461 (18%)


  Fly   784 EEHIQEI-KENMNNVEDKVYASFCRRLGVKNIRQYEERELVMQQERARK----------RAEFEQ 837
            ||::.|: |.|.             |...:||..|.:..|.:.::.|.:          ..||:.
 Worm   113 EEYLLELGKMNF-------------RFAGQNISVYNKTTLKVTRKSAEELGAFFDIVSNSIEFKP 164

  Fly   838 QIDSINSQLDFEKQKDTKKNVERWER---SVQDEEDALEGLKLAEARYL--KEIDEDKEKM--EK 895
            :.|.:.::|:|     .:..|.||.:   |::.|::....|.|.:. ||  |||.|.|||.  |:
 Worm   165 EYDELKAKLNF-----AESTVLRWAKMIDSIELEKEKFITLTLYKL-YLCDKEIQETKEKFVAEQ 223

  Fly   896 FKQD-KQAKKQ-AVDDMEEDISKA------RKDVANLAKEIHNVGSHLSAVE---SKIEAKKNER 949
            .|.: |.||.. .:....|.|.|.      :.:...:..:.||...:|..|:   |.:..|..||
 Worm   224 LKVNAKNAKMPLRISRYSEAIPKQTPSPNFKNNAIVVRPKTHNHYDNLITVDKLNSYLNEKVTER 288

  Fly   950 QNILLQAKTDCIVVPLLRGSLDDAVRQSDPDVPSTSAAMENIIEVDYSSLPREYTKLKDD---SA 1011
            :.:|..|        :...:::....:..|::.:.        |:||:.||..|.|..||   ::
 Worm   289 RELLQFA--------VNHPNMNIRFSEEGPNIYAR--------EIDYTELPEYYKKESDDIIATS 337

  Fly  1012 FKKTHEMLQKDL----QSKLDVLERIQTPNMKALQKLDAVTEKVQSTNEEFENARKKAKRAKAAF 1072
            :|::  ||:|::    |..||      ..|:|....:|.:..:::....:...|......|:..:
 Worm   338 YKRS--MLEKEIKKIRQCWLD------ENNIKDDANIDNINMRIKEATTKHTLALNIESEARLNW 394

  Fly  1073 ERVKNERSSRFVACCQHISDAIDGIYKKLARNEAAQAYIGPDNPEEPYLDGINYNCVAPGKRFQP 1137
            |:::..||:||......:..::..||.::|::|.:.|::.|.:.||||| .|:............
 Worm   395 EKLRVMRSARFNNFMAPLQTSLSRIYAEIAQDEDSLAFLRPLDEEEPYL-AIDAFVKERHSEHIS 458

  Fly  1138 MNNLSGGEKTIAALALLFSTHSFHPAPFFVLDEIDAALDNTNIGKVASYIRDHTTNLQT-IVISL 1201
            .....||.:.|..|||:|:.|.:.|:|..|:|:||..|.:....|:..|:   :...|| .:::.
 Worm   459 TRTFHGGSRMIVDLALIFAIHEWKPSPLVVIDDIDRNLYHEASKKIEPYL---SRQKQTQFIVTT 520

  Fly  1202 KEEFY 1206
            ||:.|
 Worm   521 KEDSY 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SMC1NP_651211.2 Smc 26..1216 CDD:224117 111/461 (24%)
ABC_SMC1_euk 27..>171 CDD:213242
SMC_hinge 535..653 CDD:214944
DUF4700 <697..>810 CDD:292399 6/27 (22%)
ABC_SMC1_euk <1130..1232 CDD:213242 22/79 (28%)
smcl-1NP_509956.2 ABC_ATPase 8..>123 CDD:330224 4/10 (40%)
SMC_N <112..520 CDD:330553 108/454 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.