DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp68 and AT3G09440

Sequence 1:NP_524474.1 Gene:Hsp68 FlyBaseID:FBgn0001230 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001189847.1 Gene:AT3G09440 AraportID:AT3G09440 Length:649 Species:Arabidopsis thaliana

Alignment Length:649 Identity:427/650 (66%)
Similarity:524/650 (81%) Gaps:22/650 (3%)


  Fly     2 PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPKNSVFD 66
            ||||||||||||||||:|:.:||||||||||||||||||||||||||||||||||||||.|:|||
plant     8 PAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPINTVFD 72

  Fly    67 AKRLIGRRFDDSKIQEDIKHWPFKVINDNG-KPKISVEFKGANKCFSPEEISSMVLTKMKETAEA 130
            |||||||||.||.:|.|||.|||.:.:... ||.|.|.:||.:|.||.||||||:|.||:|.|||
plant    73 AKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSAEEISSMILIKMREIAEA 137

  Fly   131 YLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLK--GERNVL 193
            |||||:|:||:||||||||||||||||||.|||:||:||||||||||:||||||...  ||:|||
plant   138 YLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVL 202

  Fly   194 IFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFAEEFKRKYKKDLRSNPRAL 258
            ||||||||||||:|||:|| :|||::|||||||||||||||:||||.:|||||.|||:..|||||
plant   203 IFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRAL 266

  Fly   259 RRLRTAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARFEELCGDLFRNTLEPVEKALKDAK 323
            ||||||.|||||||||:.:.::|||:|::|.|||:.::|||||||..||||..:|||||.|:|||
plant   267 RRLRTACERAKRTLSSTAQTTIEIDSLFDGIDFYAPITRARFEELNIDLFRKCMEPVEKCLRDAK 331

  Fly   324 MDKSQIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAAIQAAILSGDKSSEIKD 388
            |||:.|.|:|||||||||||||.||.:||.||.|..|||||||||||||:|||||||:.:.:::|
plant   332 MDKNSIDDVVLVGGSTRIPKVQQLLVDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQD 396

  Fly   389 VLLVDVAPLSLGIETAGGVMTKLIERNSRIPCKQSKTFTTYADNQPAVTIQVFEGERALTKDNNV 453
            :||:||.|||||:||||||||.||:||:.||.|:.:.|:||:||||.|.|||:|||||.|||||:
plant   397 LLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNL 461

  Fly   454 LGTFDLTGVPPAPRGVPKIDVTFDLDANGILNVTAKEQGTGNAKNITIKNDKGRLSQADIDRMLS 518
            ||.|:|:|:||||||||:|.|.||:||||||||:|:::.||....|||.|||||||:.:|::|:.
plant   462 LGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQ 526

  Fly   519 EAEKYAEEDERHRQRIAARNQLETYLFGVKEAA--ENGGDRISAADKSSIVERCSEAMKWLDSNT 581
            |||||..|||.|::::.|:|.||.|.:.::...  |..|::::..||..|.:....|::||::|.
plant   527 EAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEANQ 591

  Fly   582 TAEKEEYEYKLKELEQFCSPIMTKMHKGGGDGQQAPNFGQQAGGY----------KGPTVEEVD 635
            .||.:|:|.|:||||..|:||:.||::||..|      |..|||.          .||.:||||
plant   592 LAECDEFEDKMKELESICNPIIAKMYQGGEAG------GPAAGGMDEDVPPSAGGAGPKIEEVD 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp68NP_524474.1 PTZ00009 2..635 CDD:240227 426/648 (66%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 288/379 (76%)
AT3G09440NP_001189847.1 PTZ00009 5..649 CDD:240227 426/648 (66%)
HSPA1-2_6-8-like_NBD 9..387 CDD:212675 288/379 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.909 Consistency score
43.920

Return to query results.
Submit another query.