DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp68 and si:ch211-199o1.2

Sequence 1:NP_524474.1 Gene:Hsp68 FlyBaseID:FBgn0001230 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001093532.1 Gene:si:ch211-199o1.2 ZFINID:ZDB-GENE-060503-867 Length:639 Species:Danio rerio

Alignment Length:635 Identity:453/636 (71%)
Similarity:540/636 (85%) Gaps:3/636 (0%)


  Fly     3 AIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPKNSVFDA 67
            :||||||||||||||||:|||||||||||||||||||||||:||||||||||||||||.|::|||
Zfish     6 SIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDA 70

  Fly    68 KRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEAYL 132
            ||||||:|||..:|.|:|.||||||:::||||:.||:||.||.|.|||||||||.||:|.|||||
Zfish    71 KRLIGRKFDDQVVQSDMKLWPFKVISEDGKPKVQVEYKGENKTFYPEEISSMVLVKMREIAEAYL 135

  Fly   133 GTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDL 197
            |..|.:|||||||||||||||||||||.|||:|||||||||||||:||||||..|||||||||||
Zfish   136 GHRVNNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGRKGERNVLIFDL 200

  Fly   198 GGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFAEEFKRKYKKDLRSNPRALRRLR 262
            ||||||||||||::| :|||::|||||||||||||||:|.||.||||||:|||:..|.||:||||
Zfish   201 GGGTFDVSILTIEDG-IFEVKATAGDTHLGGEDFDNRMVKHFVEEFKRKHKKDISQNKRAVRRLR 264

  Fly   263 TAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARFEELCGDLFRNTLEPVEKALKDAKMDKS 327
            ||.||||||||||::||:|||:|:||.|||:.::|||||||..:|||.||:||||||:|||||||
Zfish   265 TACERAKRTLSSSSQASIEIDSLFEGIDFYTSITRARFEELNAELFRGTLDPVEKALRDAKMDKS 329

  Fly   328 QIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAAIQAAILSGDKSSEIKDVLLV 392
            ||.|||||||||||||:|.|||:||.|:.||.|||||||||||||:|||||.||.|..::|:||:
Zfish   330 QIQDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSENVQDLLLL 394

  Fly   393 DVAPLSLGIETAGGVMTKLIERNSRIPCKQSKTFTTYADNQPAVTIQVFEGERALTKDNNVLGTF 457
            |||||||||||||||||.||:||:.||.||::.|:||:||||.|.|||||||||:|||||:||.|
Zfish   395 DVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFSTYSDNQPGVLIQVFEGERAMTKDNNLLGKF 459

  Fly   458 DLTGVPPAPRGVPKIDVTFDLDANGILNVTAKEQGTGNAKNITIKNDKGRLSQADIDRMLSEAEK 522
            ||||:||||||||:|:||||:||||||||:|.::.||....|||.|||||||:.||:||:.:|||
Zfish   460 DLTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKENKITITNDKGRLSKEDIERMVQDAEK 524

  Fly   523 YAEEDERHRQRIAARNQLETYLFGVKEAA--ENGGDRISAADKSSIVERCSEAMKWLDSNTTAEK 585
            |..|||..|::|||:|.||:|.|.:|...  ||...:||..||..|:::|:|.:.||::|..|||
Zfish   525 YKAEDEVQREKIAAKNALESYAFSMKNTVEDENLRGKISEQDKKKIIDKCTEVVSWLENNQLAEK 589

  Fly   586 EEYEYKLKELEQFCSPIMTKMHKGGGDGQQAPNFGQQAGGYKGPTVEEVD 635
            ||||:..||||..|:||::::::||........|..|....:|||:||||
Zfish   590 EEYEHHQKELESVCNPIISRLYQGGAPPAGGCGFQAQPESSQGPTIEEVD 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp68NP_524474.1 PTZ00009 2..635 CDD:240227 452/634 (71%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 301/376 (80%)
si:ch211-199o1.2NP_001093532.1 HSP70 1..639 CDD:331774 452/634 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.