DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp68 and hsp70l

Sequence 1:NP_524474.1 Gene:Hsp68 FlyBaseID:FBgn0001230 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001107061.1 Gene:hsp70l ZFINID:ZDB-GENE-050321-1 Length:643 Species:Danio rerio

Alignment Length:641 Identity:462/642 (72%)
Similarity:551/642 (86%) Gaps:13/642 (2%)


  Fly     3 AIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPKNSVFDA 67
            |||||||||||||||||:|||||||||||||||||||||||:||||||||||||||||.|:||||
Zfish     8 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDA 72

  Fly    68 KRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEAYL 132
            ||||||||||..:|.|:|||.|||::|.||||::||.||.||.|:|||||||||.||||.|||||
Zfish    73 KRLIGRRFDDPVVQSDMKHWSFKVVSDGGKPKVAVEHKGENKTFNPEEISSMVLVKMKEIAEAYL 137

  Fly   133 GTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDL 197
            |..|.:||||||||||||||:||||||.|||:|||||||||||||:||||||....|||||||||
Zfish   138 GQKVTNAVITVPAYFNDSQRRATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKSSERNVLIFDL 202

  Fly   198 GGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFAEEFKRKYKKDLRSNPRALRRLR 262
            ||||||||||||::| :|||::|||||||||||||||:||||.||||||:|||:..|.|||||||
Zfish   203 GGGTFDVSILTIEDG-IFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRALRRLR 266

  Fly   263 TAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARFEELCGDLFRNTLEPVEKALKDAKMDKS 327
            ||.||||||||.|::||:|||:||||.|||:.::||||||||.||||.||:||||||:||||||:
Zfish   267 TACERAKRTLSPSSQASIEIDSLYEGIDFYTSITRARFEELCSDLFRGTLDPVEKALRDAKMDKA 331

  Fly   328 QIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAAIQAAILSGDKSSEIKDVLLV 392
            ||||||||||||||||:|.|||:||.|:.||.|||||||||||||:|||||.||.|..::|:||:
Zfish   332 QIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLL 396

  Fly   393 DVAPLSLGIETAGGVMTKLIERNSRIPCKQSKTFTTYADNQPAVTIQVFEGERALTKDNNVLGTF 457
            |||||||||||||||||.||:||:.||.||::|||||:||||.|.|||||||||:|||||:||.|
Zfish   397 DVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKF 461

  Fly   458 DLTGVPPAPRGVPKIDVTFDLDANGILNVTAKEQGTGNAKNITIKNDKGRLSQADIDRMLSEAEK 522
            :|||:||||||||:|:||||:||||||||:|.::.||....|||.|||||||:.:|:||:.||:|
Zfish   462 ELTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKQNRITITNDKGRLSKEEIERMVQEADK 526

  Fly   523 YAEEDERHRQRIAARNQLETYLFGVKEAAE--NGGDRISAADKSSIVERCSEAMKWLDSNTTAEK 585
            |..||:..|::|:|:|.||:|.|.:|.:.|  |...:||..||..:||:|:||:.||::|..|:|
Zfish   527 YKAEDDLQREKISAKNSLESYAFNMKNSVEDDNLKGKISEEDKKRVVEKCNEAVSWLENNQLADK 591

  Fly   586 EEYEYKLKELEQFCSPIMTKMHKG----GGDGQQAPNFGQQAGG--YKGPTVEEVD 635
            ||||::|||||:.|:|:::|:::|    ||.|.||    :.|.|  .:|||:||||
Zfish   592 EEYEHQLKELEKVCNPVISKLYQGGMPAGGCGAQA----RAASGASAQGPTIEEVD 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp68NP_524474.1 PTZ00009 2..635 CDD:240227 461/640 (72%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 306/376 (81%)
hsp70lNP_001107061.1 PTZ00009 5..643 CDD:240227 461/640 (72%)
HSPA1-2_6-8-like_NBD 8..383 CDD:212675 306/376 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.