DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp68 and hsph1

Sequence 1:NP_524474.1 Gene:Hsp68 FlyBaseID:FBgn0001230 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_001919957.2 Gene:hsph1 ZFINID:ZDB-GENE-120410-4 Length:901 Species:Danio rerio

Alignment Length:701 Identity:207/702 (29%)
Similarity:346/702 (49%) Gaps:107/702 (15%)


  Fly     1 MPAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPKNSVF 65
            |..:|.|:|....|:.|.:.|.:|.::|:..:|.|||.::|....|.||:|||||:..||.::||
Zfish    63 MAVVGFDVGFQNCCIAVVKSGGIETVSNEFTDRCTPSVISFGSKNRAIGNAAKNQMITNPSSTVF 127

  Fly    66 DAKRLIGRRFDDSKIQEDIKHWPFKVI--NDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETA 128
            ..|||..|.:.|..:|.:..:.|:.::  || ||..:.|.:......||.|:||:|:|||:|:.|
Zfish   128 HFKRLHSRLYHDKVVQAEKANLPYDLVPLND-GKVGVQVMYLDQEHHFSIEQISAMLLTKLKDIA 191

  Fly   129 EAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDK-NLKGE--- 189
            ||.|...|.:.||::|::|.||:|::..||..|||:|.|:::|:.||.||.||:.| :|.|.   
Zfish   192 EANLQKKVLECVISIPSFFTDSERRSVLDAAKIAGLNCLKLMNDSTAVALNYGIYKEDLPGSDEN 256

  Fly   190 -RNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFAEEFKRKYKKDLRS 253
             :.|...|||...|.|||...:.|.: :|.|||.|.:|||:|||.|||:||..|||.||..|::|
Zfish   257 PKIVAFVDLGHSAFQVSICAFNRGKV-KVLSTAFDPYLGGKDFDQRLVDHFCAEFKSKYMMDVKS 320

  Fly   254 NPRALRRLRTAAERAKRTLSS-STEASLEIDALYEGHDFYSKVSRARFEELCGDLFRNTLEPVEK 317
            ..|||.||....|:.|:.:|| |||.||.|:...:..|...:::||:|||:|.||.......:.|
Zfish   321 KTRALLRLTQECEKLKKLMSSNSTELSLNIECFIDDKDVCGRMNRAKFEEMCADLIERVKFTLMK 385

  Fly   318 ALKDAKMDKSQIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAAIQAAILSGDK 382
            |::.|.:....|..:.:|||:||||.|:..:.:|| .:.::.::|.|||||.|.|:|.|:||  .
Zfish   386 AVEQAGVRLQDISAVEIVGGATRIPAVKAQISSFF-RRDVSTTLNADEAVARGCALQCAMLS--P 447

  Fly   383 SSEIKDVLLVDVAPLSLGIETA-----GGVMTKLIERNSRIPCKQSKTFTTYADNQPAVTIQVFE 442
            :..:::..:.||.|..:.:..:     |....::..||.  ||..:|..|.|. |:|.:....:.
Zfish   448 AFRVREFSITDVIPFPISLSWSSEADEGKSCHEIFSRNH--PCPSAKMITFYR-NKPFILEAFYS 509

  Fly   443 GERALTKDNNVLGTFDLTGVPPAP-RGVPKIDVTFDLDANGILNVTA------------------ 488
            .:.:|......:|.:.:..:.|.. |...|:.|..:::.:|:::|::                  
Zfish   510 DKSSLPFPEAKIGEYKVQNIQPQENREKAKVKVKVEVNRSGVVSVSSAAVVLRVRSDESEITEIN 574

  Fly   489 -----------------------------------------KEQ---------GTGNA------- 496
                                                     |||         |..|:       
Zfish   575 EDVDSHDASDDTDVQDKTEEVNIELSVNKENLPTAQCPPMEKEQNQRETLSMNGEVNSHPPHAKK 639

  Fly   497 -----KNITIKNDKGRLSQADIDRMLSEAE---KYAEEDERHRQRIAARNQLETYLFGVKEAAEN 553
                 |::.:..::....|...||:.:..|   |..::|.:.::|..|:|.:|..::..:...|.
Zfish   640 AKMKVKHVVLPMEETFNQQLPKDRLSAYTEQENKMIQQDRQEKERNNAKNAVEENVYYFRHKLEG 704

  Fly   554 GGDR-ISAADKSSIVERCSEAMKWL-DSNTTAEKEEYEYKLKELEQFCSPI 602
            .... ::|.:..:..|..:....|| |.....:|:.|..:|.|:.:...|:
Zfish   705 SYQTFLNAQEHQAFSELLNGTENWLYDEGADQDKQTYINRLAEIHKLGLPV 755

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp68NP_524474.1 PTZ00009 2..635 CDD:240227 206/701 (29%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 157/384 (41%)
hsph1XP_001919957.2 HSPH1_NBD 64..446 CDD:212689 157/385 (41%)
HSP70 65..761 CDD:278441 206/700 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.