DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp68 and Hspa14

Sequence 1:NP_524474.1 Gene:Hsp68 FlyBaseID:FBgn0001230 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_056580.2 Gene:Hspa14 MGIID:1354164 Length:509 Species:Mus musculus

Alignment Length:508 Identity:179/509 (35%)
Similarity:291/509 (57%) Gaps:8/509 (2%)


  Fly     1 MPAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPKNSVF 65
            |.|||:.||.|.:||.|::.|:.:::|||.|:|.||:.||:::.|:::|.|||.....:..::|.
Mouse     1 MAAIGVHLGCTSACVAVYKDGRADVVANDAGDRVTPAIVAYSEREQVVGLAAKQSRIRHVSSTVV 65

  Fly    66 DAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSMVLTKMKETAEA 130
            ..|:::||...|.:.|:.|......||..|||.:..::.....|..:||:::.::.:||||||.:
Mouse    66 KVKQILGRSSADPQAQKYISESKCLVIEKNGKLRYEIDTGEETKLVNPEDVARLIFSKMKETAHS 130

  Fly   131 YLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDK-NLKGERNVLI 194
            .||:...|.|:|||..|.:.|:.|..:|...||.||||:|:||:||.||||:.: :..|:.|||:
Mouse   131 VLGSDANDVVVTVPFDFGEKQKSALGEAAGAAGFNVLRLIHEPSAALLAYGIGQDHPTGKSNVLV 195

  Fly   195 FDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFAEEFKRKYKKDLRSNPRALR 259
            |.|||.:..:|::.::.| ::.|.||....::||..|.:.|..:.|.||:|.:|.|:|.|.||:.
Mouse   196 FKLGGTSLSLSVMEVNSG-MYRVLSTNTSDNIGGAHFTDTLAQYLASEFQRLFKHDVRGNARAMM 259

  Fly   260 RLRTAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARFEELCGDLFRNTLEPVEKALKDAKM 324
            :|..:||.||.:||:...|:..:|:||||.||...|||||||.||..||....|.:.:.|:....
Mouse   260 KLMNSAEVAKHSLSTLGSANCFVDSLYEGQDFDCNVSRARFELLCSPLFNKCTEAIRELLRQTGF 324

  Fly   325 DKSQIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAAIQAAILSGDKSSEIKDV 389
            ....|:.:||.|||:||||:|.|:::.|....|..||.|||.:..||||:|.||.|.:|:...|.
Mouse   325 TADDINKVVLCGGSSRIPKLQQLIKDLFPAVDLLNSIPPDEVIPIGAAIEAGILVGKESTSGDDS 389

  Fly   390 LLVDVAP---LSLGIETAGG-VMTKLIERNSRIPCKQSKTFTTYADNQPAVTIQVFEGE-RALTK 449
            ::::.:.   |..|::.:|. ..|.|....:.:|.::..|... .....:|.::::|.| :...|
Mouse   390 VMIECSAKDILVKGVDESGADRFTVLFPSGTPLPARRQHTLQA-PGRVSSVCLELYESEGKNSAK 453

  Fly   450 DNNVLGTFDLTGVPPAPRGVPKIDVTFDLDANGILNVTAKEQGTGNAKNITIK 502
            :........|..:.....|:..|.....:..:|.|.||..:|.||..:.||::
Mouse   454 EEAKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLQVTCTDQDTGKCEAITVE 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp68NP_524474.1 PTZ00009 2..635 CDD:240227 178/508 (35%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 152/377 (40%)
Hspa14NP_056580.2 HSPA14-like_NBD 2..376 CDD:212680 150/375 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.