DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp68 and HSPA5

Sequence 1:NP_524474.1 Gene:Hsp68 FlyBaseID:FBgn0001230 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_005338.1 Gene:HSPA5 HGNCID:5238 Length:654 Species:Homo sapiens

Alignment Length:624 Identity:374/625 (60%)
Similarity:494/625 (79%) Gaps:13/625 (2%)


  Fly     4 IGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNPKNSVFDA 67
            :||||||||||||||:.|:|||||||||||.|||||||| :.|||||||||||:..||:|:||||
Human    31 VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDA 95

  Fly    68 KRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGA-NKCFSPEEISSMVLTKMKETAEAY 131
            ||||||.::|..:|:|||..||||:....||.|.|:..|. .|.|:|||||:|||||||||||||
Human    96 KRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAY 160

  Fly   132 LGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFD 196
            ||..|..||:||||||||:|||||||||.|||:||:||||||||||:||||||. :||:|:|:||
Human   161 LGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFD 224

  Fly   197 LGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFAEEFKRKYKKDLRSNPRALRRL 261
            |||||||||:||||.| :|||.:|.|||||||||||.|::.||.:.:|:|..||:|.:.||:::|
Human   225 LGGGTFDVSLLTIDNG-VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKL 288

  Fly   262 RTAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARFEELCGDLFRNTLEPVEKALKDAKMDK 326
            |...|:|||.|||..:|.:||::.|||.||...::||:||||..||||:|::||:|.|:|:.:.|
Human   289 RREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKK 353

  Fly   327 SQIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAAIQAAILSGDKSSEIKDVLL 391
            |.|.:||||||||||||:|.|::.||.||..:..||||||||||||:||.:||||:  :..|::|
Human   354 SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQ--DTGDLVL 416

  Fly   392 VDVAPLSLGIETAGGVMTKLIERNSRIPCKQSKTFTTYADNQPAVTIQVFEGERALTKDNNVLGT 456
            :||.||:|||||.||||||||.||:.:|.|:|:.|:|.:||||.|||:|:||||.|||||::|||
Human   417 LDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGT 481

  Fly   457 FDLTGVPPAPRGVPKIDVTFDLDANGILNVTAKEQGTGNAKNITIKNDKGRLSQADIDRMLSEAE 521
            |||||:||||||||:|:|||::|.||||.|||:::||||...|||.||:.||:..:|:||:::||
Human   482 FDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAE 546

  Fly   522 KYAEEDERHRQRIAARNQLETYLFGVKEA---AENGGDRISAADKSSIVERCSEAMKWLDSNTTA 583
            |:||||::.::||..||:||:|.:.:|..   .|..|.::|:.||.::.:...|.::||:|:..|
Human   547 KFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDA 611

  Fly   584 EKEEYEYKLKELEQFCSPIMTKMHKGGGDGQQAPNFGQQ 622
            :.|:::.|.||||:...||::|::...|    .|..|::
Human   612 DIEDFKAKKKELEEIVQPIISKLYGSAG----PPPTGEE 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp68NP_524474.1 PTZ00009 2..635 CDD:240227 374/625 (60%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 249/377 (66%)
HSPA5NP_005338.1 HSP70 30..635 CDD:306516 371/608 (61%)
Nucleotide-binding (NBD). {ECO:0000303|PubMed:28286085} 125..280 111/157 (71%)
Interdomain linker. {ECO:0000250|UniProtKB:G3I8R9} 409..419 3/12 (25%)
Substrate-binding (SBD). {ECO:0000303|PubMed:28286085} 420..500 57/80 (71%)
Prevents secretion from ER. {ECO:0000255} 651..654
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.