DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg6 and becn1

DIOPT Version :8

Sequence 1:NP_651209.1 Gene:Atg6 / 42850 FlyBaseID:FBgn0264325 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_017953257.1 Gene:becn1 / 619357 XenbaseID:XB-GENE-999318 Length:459 Species:Xenopus tropicalis

Alignment Length:456 Identity:221/457 (48%)
Similarity:297/457 (65%) Gaps:41/457 (9%)


  Fly     2 SEAEKQAVSFACQRCLQPIVLDEQLEKISVHAMAELSLPIYGDNGNTLDPQDASSFD-------- 58
            |::....|||.||||.||:.||...:.:....|.||:.|:.  ....:.|.|....|        
 Frog     4 SKSSTMQVSFVCQRCSQPLKLDTSFKILDKVTMQELTAPLV--TTAAVKPGDIQEVDSNIEETFA 66

  Fly    59 ---------HFVPPYRLTDSINGTGFMLV---SDGRDNKKMSAAFKLKAELFDCLSSNSEIDHPL 111
                     ..:||.|:..:.:.|.|.|:   |||...:.:|...|:..:|||.:|..:::||||
 Frog    67 ENRTDGVSRRLIPPARMMSTESATSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPL 131

  Fly   112 CEECADSMLEIMDRELRIAEDEWDVYKAYLDELEQQRVAPNVEALDKELDELKRSEQQLLSELKE 176
            ||||.|::|:.:|.:|.|.|:|...||..|:.||:.. ..:.|.|:.:|.||...|.:|:.||:|
 Frog   132 CEECTDTLLDQLDTQLNITENECQNYKRCLEILERMN-EDDKEKLEAKLKELAEDEDRLIQELEE 195

  Fly   177 LKKEEQSLNDAIAEEEQEREELHEQEESYWREYTKHRRELMLTEDDKRSLECQIAYSKQQLDKLR 241
            :::..:.:...|.:..:|.|.|.::|..|.:||::.:|:.:..:||.:|:|.|:.|::.|||||:
 Frog   196 VERNRELVAKDIEKVREEAERLEQEEARYQKEYSEFKRQQLELDDDLKSVENQMRYAQIQLDKLK 260

  Fly   242 DTNIFNITFHIWHAGHFGTINNFRLGRLPSVSVDWSEINAAWGQTVLLLSALARKIGLTFERYRV 306
            .||:||.||||||:|.|||||||||||||||.|:|:|||||||||||||.|||.|:||.|:|||:
 Frog   261 KTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLQFQRYRL 325

  Fly   307 VPFGNHSYVEVL-GENRELPLYGSGGFKFFWDTKFDAAMVAFLDCLTQFQKEVEKRDTEFLLPYK 370
            :|||||||:|.| .:::|||||.|||.:||||.|||.||||||||:.||::||||.||.|.|||:
 Frog   326 MPFGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGDTGFCLPYR 390

  Fly   371 ----------------MEKGKIIDP-STGNSYSIKIQFNSEEQWTKALKFMLTNLKWGLAWVSSQ 418
                            :|||||.|. .:|.|||||.|||||||||||||||||||||||||||||
 Frog   391 FVLLFLVFSFSLLRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQ 455

  Fly   419 F 419
            |
 Frog   456 F 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atg6NP_651209.1 APG6 110..418 CDD:282029 183/326 (56%)
becn1XP_017953257.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355983723
eggNOG 1 0.900 E1_KOG2751
Hieranoid 1 1.000
Homologene 1 1.000 H2794
Inparanoid 1 1.050 427 1.000 Inparanoid score I1619
OMA 1 1.010
OrthoDB 1 1.010 D1085752at2759
OrthoFinder 1 1.000 FOG0002520
OrthoInspector 1 1.000 T1059902
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1774
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.