DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg6 and Becn2

DIOPT Version :8

Sequence 1:NP_651209.1 Gene:Atg6 / 42850 FlyBaseID:FBgn0264325 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_001059251.2 Gene:Becn2 / 289269 RGDID:1563293 Length:419 Species:Rattus norvegicus

Alignment Length:431 Identity:150/432 (35%)
Similarity:228/432 (53%) Gaps:43/432 (10%)


  Fly    11 FACQRCLQPIVLDEQ----LEKISVHAMAELSLPIYG------------DNGNTLDPQDASSFDH 59
            |.|.||.:|:.|.:|    || :..||.....:|:.|            |.|.|.......:   
  Rat     6 FLCHRCNEPLKLLQQQGGPLE-VQHHANLPTEMPVSGQSRVRTSHRAHSDGGRTCQGGACCT--- 66

  Fly    60 FVPPYRLTDSINGTGFMLVSDGRDNKKMSAAFKLKAELFDCLSSNSEIDHPLCEECADSMLEIMD 124
                           |.|:.:....:.:........|:|:.||....:|||||.:|.|::|..:|
  Rat    67 ---------------FTLLGESVSVRTLHTVQNTTIEIFEILSEQKVVDHPLCVDCTDNLLVQLD 116

  Fly   125 RELRIAEDEWDVYKAYLDE----LEQQRVAPNVEALDKELDELKRSEQQLLSELKELKKEEQSLN 185
            .:|.:...:...|:.:|:.    .|::..|.:.| |..||..|::.|.:|:.||::|......:.
  Rat   117 DQLTLVASDNQSYQGFLERQSLVSEEETEALHAE-LRAELSGLEQEEARLVQELEDLDGHHARVA 180

  Fly   186 DAIAEEEQEREELHEQEESYWREYTKHRRELMLTEDDKRSLECQIAYSKQQLDKLRDTNIFNITF 250
            ..:...:.|.:||::|.|.:...|:..:.|.:...|...|:|.|:.|:..||..||.|:||:.||
  Rat   181 AELRAAQAESKELYQQNEEHRASYSVLKMEQLELTDQLSSVENQLQYALGQLCHLRKTSIFDATF 245

  Fly   251 HIWHAGHFGTINNFRLGRLPSVSVDWSEINAAWGQTVLLLSALARKIGLTFERYRVVPFGNHSYV 315
            .|...|..|.|||||||.||:|.|.|:|||||||||.|||.:|::..||.|:||::||.|:|||:
  Rat   246 TISDDGPLGMINNFRLGCLPAVRVGWTEINAAWGQTALLLFSLSKMAGLQFQRYQLVPLGDHSYL 310

  Fly   316 EVLGENRELPLYGSGGFKFFWDTKFDAAMVAFLDCLTQFQKEVEKRDTEFLLPYKME--KGKIID 378
            :.|..:..|||:..|....|.:..||.||.||||||.||.:|.||.:....|||::.  :|.:.|
  Rat   311 KSLTADEVLPLFSDGNHSVFLNNTFDCAMKAFLDCLQQFVEETEKDERYPCLPYRIHPLEGVMED 375

  Fly   379 -PSTGNSYSIKIQFNSEEQWTKALKFMLTNLKWGLAWVSSQ 418
             ..:|:...|:...|:||:|::||||||.:||..:||.||:
  Rat   376 IGDSGDCCPIRTHLNTEEEWSRALKFMLADLKLIVAWASSR 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atg6NP_651209.1 APG6 110..418 CDD:282029 126/315 (40%)
Becn2XP_001059251.2 APG6 102..416 CDD:282029 126/315 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355975621
eggNOG 1 0.900 E1_KOG2751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1085752at2759
OrthoFinder 1 1.000 FOG0002520
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12768
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.