DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg6 and bec-1

DIOPT Version :8

Sequence 1:NP_651209.1 Gene:Atg6 / 42850 FlyBaseID:FBgn0264325 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_500844.1 Gene:bec-1 / 177345 WormBaseID:WBGene00000247 Length:375 Species:Caenorhabditis elegans

Alignment Length:352 Identity:104/353 (29%)
Similarity:178/353 (50%) Gaps:37/353 (10%)


  Fly    80 DGRDNKKMSAAFKLKAELFDCLSSNSE------------IDHPLCEECADSMLEIMDRELRIAED 132
            |..|::|     |.:..:.:.|:.:|.            .|.|:|.:|:|::...||.::...:|
 Worm    26 DSADSEK-----KSETVITEALTGHSRNLMKLISDAQFPSDAPVCNDCSDALRNEMDAQVATLDD 85

  Fly   133 EWDVYKAYLDELEQQRVAPNVEALDKELDELKRSEQQLLSELKELKKEEQSLNDAIAEEEQEREE 197
            |...|:.|::.|::.....::..|..:|..:...|::|..:||:|..||:.|:..:..:.:..|.
 Worm    86 EIKTYQTYINYLKENHPTTSIPDLKAKLQNVSDEEKELEQQLKKLLAEEEQLDLDLQTKRRTAEA 150

  Fly   198 LHEQEESYWREYTKHRRELMLTEDDKRSLECQIAYSKQQLDKLRDTNIFNITFHIWHAGHFGTIN 262
            ..|:....|::|..:.|::...:|:..|||.:..|::.|..||.|||:.::.||||..|..|.||
 Worm   151 ASEKSGELWKKYRDNLRQVFEDQDELHSLEAERQYAEVQHRKLTDTNVLDLCFHIWVDGIVGEIN 215

  Fly   263 NFRLGRLPSVSVDWSEINAAWGQTVLLLSALARKIGLTFERYRVVPFGNHSYVEVLGENREL--- 324
            .||||.|....|:::|||||.||.||||..|..:||:.......|..|:|||:::.....::   
 Worm   216 GFRLGYLKDAPVEFTEINAALGQIVLLLEILLERIGVQHHELMPVAMGSHSYIKLRRNGIDMETY 280

  Fly   325 -------PLYGSGGFKFFWDTKFDAAMVAFLDCLTQFQKEVEKRDTEFLLPYKMEKGKIIDPSTG 382
                   ||.||.|        .|..:..||..|....||::.|:..|..||::....::|  .|
 Worm   281 ALYGQGTPLSGSSG--------IDPGIRRFLQLLEFLLKELKDRNKNFKPPYQIHADSLVD--NG 335

  Fly   383 NSYSIKIQFNSEEQWTKALKFMLTNLK 409
            ..|:..:..|::.:||:|:..|||:||
 Worm   336 VKYNAVMTLNTDVRWTRAMALMLTDLK 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atg6NP_651209.1 APG6 110..418 CDD:282029 97/311 (31%)
bec-1NP_500844.1 APG6 63..366 CDD:282029 97/311 (31%)
DUF342 <70..149 CDD:302792 18/79 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355485105
eggNOG 1 0.900 E1_KOG2751
Hieranoid 1 1.000
Homologene 1 1.000 H2794
Inparanoid 1 1.050 176 1.000 Inparanoid score I2664
Isobase 1 0.950 0 Normalized mean entropy S2331
OMA 1 1.010
OrthoDB 1 1.010 D1085752at2759
OrthoFinder 1 1.000 FOG0002520
OrthoInspector 1 1.000 T477196
orthoMCL 1 0.900 OOG5_128989
Panther 1 1.100 LDO PTHR12768
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1774
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.