DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AP-1sigma and or

Sequence 1:NP_001247273.1 Gene:AP-1sigma FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster

Alignment Length:152 Identity:52/153 (34%)
Similarity:95/153 (62%) Gaps:6/153 (4%)


  Fly     1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLE------WKDCKIVY 59
            |:..:|:|:..||.||.|:|..:.:.::::|.:|....:..|...:|:|||      ..|.|::|
  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65

  Fly    60 KRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQ 124
            :.||:|||...::.:::||..|::|..:||.|||.|.:|||||:||:.:..:.||.||::||.:.
  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130

  Fly   125 ETSKKNVLKAIASQDLLQEDEA 146
            :|:..:::..|..|:.:.:.||
  Fly   131 QTNMNDIMARIEEQNKIVKQEA 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AP-1sigmaNP_001247273.1 Clat_adaptor_s 1..142 CDD:250451 50/147 (34%)
orNP_536793.1 APS2 1..143 CDD:227363 49/142 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C77228189
eggNOG 1 0.900 E1_COG5030
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11753
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.