DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pli and PELI1

Sequence 1:NP_001097890.1 Gene:Pli FlyBaseID:FBgn0025574 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_065702.2 Gene:PELI1 HGNCID:8827 Length:418 Species:Homo sapiens

Alignment Length:409 Identity:247/410 (60%)
Similarity:309/410 (75%) Gaps:9/410 (2%)


  Fly    23 KPRLRYGELVILGYNGYLPQGDRGRRRSKFVLHKRTEASGVKRSKHYIVQSPQTSKAILDANQHS 87
            |..::||||::|||||.||.||||||:|:|.|.||.:|:|||.|..:|..:||.:|||.:.:|||
Human    12 KAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHS 76

  Fly    88 ISYTLSRNQAVIVEYKEDTETDMFQVGRSSESPIDFVVMDTLPGDK--KDAKVMQSTISRFACRI 150
            |||||||.|.|:|||..|:.|||||:|||:||||||||.||:||.:  .|.:.:|||||||||||
Human    77 ISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRI 141

  Fly   151 LVNRCEPAKARIFAAGFDSSRNIFLGEKATKWQ-DNVEIDGLTTNGVLIMHPKGSFCGGNAKCGL 214
            :..|..|..|||:|||||||:||||||||.||: .:.::|||||||||:|||:..|. .::|.|:
Human   142 ICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFT-EDSKPGI 205

  Fly   215 WRECSVGGDVFSLRESRSAQQKGQPIYDECNILQDGTLIDLCGATLLWRSAEGLQHSPTKHDLEK 279
            |||.||.|:||||||:|||||:|:.:..|.|.||||:||||||||||||:||||.|:||...||.
Human   206 WREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEA 270

  Fly   280 LIDAINAGRPQCPVGLNTLVIP--RKVNIGDQVNQPYVYLNCGHVQGHHDWG-QDENTGA-RRCP 340
            |...|||.|||||||.|||..|  ::.::.|: .||:||||||||.|:|:|| ::|..|. |.||
Human   271 LRQEINAARPQCPVGFNTLAFPSMKRKDVVDE-KQPWVYLNCGHVHGYHNWGNKEERDGKDRECP 334

  Fly   341 MCLELGPVVTLCMGLEPAFYVDVGAPTYAFNPCGHMATEKTVKYWANVEIPHGTNGFQAVCPFCA 405
            ||..:||.|.|.:|.|..||||.|.||:||:||||:.:|||..||:.:.:||||:.|.|.|||||
Human   335 MCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCA 399

  Fly   406 TPLDGATGYIKLIFQDNLD 424
            ..|.|..|||:||||..||
Human   400 HQLAGEQGYIRLIFQGPLD 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PliNP_001097890.1 Pellino 21..424 CDD:282553 246/408 (60%)
PELI1NP_065702.2 Pellino 10..418 CDD:335871 246/408 (60%)
Ring-like domain, necessary for ubiqitination of RIPK3. {ECO:0000269|PubMed:29883609} 311..399 49/88 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C26113802
eggNOG 1 0.900 E1_KOG3842
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 502 1.000 Inparanoid score I1341
Isobase 1 0.950 0 Normalized mean entropy S2993
OMA 1 1.010
OrthoDB 1 1.010 D251367at33208
OrthoFinder 1 1.000 FOG0000914
OrthoInspector 1 1.000 T608706
orthoMCL 1 0.900 OOG5_129859
Panther 1 1.100 O PTHR12098
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4716
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.