DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pli and PELI2

Sequence 1:NP_001097890.1 Gene:Pli FlyBaseID:FBgn0025574 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_067078.1 Gene:PELI2 HGNCID:8828 Length:420 Species:Homo sapiens

Alignment Length:418 Identity:249/419 (59%)
Similarity:314/419 (75%) Gaps:12/419 (3%)


  Fly    17 GGDGH---DKPRLRYGELVILGYNGYLPQGDRGRRRSKFVLHKRTEASGVKRSKHYIVQSPQTSK 78
            |.:.|   :|..::|||||:|||||.||.||||||:|:|.|:||.:|:|||.|..:::.:||.||
Human     5 GQEEHCAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVHVISTPQASK 69

  Fly    79 AILDANQHSISYTLSRNQAVIVEYKEDTETDMFQVGRSSESPIDFVVMDTLPGDKK--DAKVMQS 141
            ||....||||||||||||.|:|||..|.:|||||||||:||||||||.||:.|.:.  :|::.||
Human    70 AISCKGQHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTISGSQNTDEAQITQS 134

  Fly   142 TISRFACRILVNRCEPAKARIFAAGFDSSRNIFLGEKATKWQD-NVEIDGLTTNGVLIMHPKGSF 205
            |||||||||:.:|.||..|||||||||||:||||||||.||:: :..:|||||||||:|||:|.|
Human   135 TISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGF 199

  Fly   206 CGGNAKCGLWRECSVGGDVFSLRESRSAQQKGQPIYDECNILQDGTLIDLCGATLLWRSAEGLQH 270
            . ..::.|:|||.||.|||::|||:|||||:|:.:..|.|:||||:||||||||||||:|:||.|
Human   200 T-EESQPGVWREISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFH 263

  Fly   271 SPTKHDLEKLIDAINAGRPQCPVGLNTLVIPRKVNIGDQV--NQPYVYLNCGHVQGHHDWGQDEN 333
            :||:..:|.|...|||.|||||||||||..| .:|..:.|  .||:.||:||||.|:|:||...:
Human   264 TPTQKHIEALRQEINAARPQCPVGLNTLAFP-SINRKEVVEEKQPWAYLSCGHVHGYHNWGHRSD 327

  Fly   334 TGA--RRCPMCLELGPVVTLCMGLEPAFYVDVGAPTYAFNPCGHMATEKTVKYWANVEIPHGTNG 396
            |.|  |.||||..:||.|.|.:|.|..||||.|.||:||.||||:.:||:.|||:.:.:||||:.
Human   328 TEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHA 392

  Fly   397 FQAVCPFCATPLDGATGYIKLIFQDNLD 424
            |.|.||||||.|.|....||||||..:|
Human   393 FHAACPFCATQLVGEQNCIKLIFQGPID 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PliNP_001097890.1 Pellino 21..424 CDD:282553 247/413 (60%)
PELI2NP_067078.1 Pellino 12..420 CDD:309722 246/410 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C26113849
eggNOG 1 0.900 E1_KOG3842
Hieranoid 1 1.000
Homologene 1 1.000 H41431
Inparanoid 1 1.050 502 1.000 Inparanoid score I1341
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D251367at33208
OrthoFinder 1 1.000 FOG0000914
OrthoInspector 1 1.000 T608706
orthoMCL 1 0.900 OOG5_129859
Panther 1 1.100 LDO PTHR12098
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4716
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.