DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pli and Peli3

Sequence 1:NP_001097890.1 Gene:Pli FlyBaseID:FBgn0025574 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001121014.1 Gene:Peli3 RGDID:1305989 Length:445 Species:Rattus norvegicus

Alignment Length:436 Identity:224/437 (51%)
Similarity:292/437 (67%) Gaps:18/437 (4%)


  Fly     4 RTDGTESP------ILAEDGGDG--HDKPRLRYGELVILGYNGYLPQGDRGRRRSKFVLHKRTEA 60
            ||...:.|      ||:..|.:.  .::| ::||||::|||||.|..||:|||||:..|.:|..|
  Rat    13 RTSDLQHPGDKGSCILSSPGEEALPGEEP-IKYGELIVLGYNGCLSSGDKGRRRSRLALSRRPHA 76

  Fly    61 SGVKRSKHYIVQSPQTSKAILDANQHSISYTLSRNQAVIVEYKEDTETDMFQVGRSSESPIDFVV 125
            :|||....:.:.:|..|||:.:..||||||||||:.:|||||..|::.||||:|||:|:.|||||
  Rat    77 NGVKPDVMHHISTPLVSKALSNRGQHSISYTLSRSHSVIVEYTHDSDKDMFQIGRSTENMIDFVV 141

  Fly   126 MDTLP-GDKKDAKVMQSTISRFACRILVNRCEPAKARIFAAGFDSSRNIFLGEKATKWQ--DNVE 187
            .||.| |...:....||||||:|||||.:|..|..|||:|||||:|.||||||:|.||:  |.: 
  Rat   142 TDTSPGGGTTEGPSAQSTISRYACRILCDRRPPYTARIYAAGFDASSNIFLGERAAKWRTPDGL- 205

  Fly   188 IDGLTTNGVLIMHPKGSFCGGNAKCGLWRECSVGGDVFSLRESRSAQQKGQPIYDECNILQDGTL 252
            :|||||||||:|||.|.|...:|. |:|||.||.|:|:.||:||||||:|:.:.:|.|:||||:|
  Rat   206 MDGLTTNGVLVMHPAGGFSEDSAP-GVWREISVCGNVYELRDSRSAQQRGKLVENESNVLQDGSL 269

  Fly   253 IDLCGATLLWRSAEGLQHSPTKHDLEKLIDAINAGRPQCPVGLNTLVI--PRKVNIGDQVNQPYV 315
            |||||||||||:..||..:||...||......||.||||||||:||..  |.:........||:|
  Rat   270 IDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTAPDKQQPWV 334

  Fly   316 YLNCGHVQGHHDWG--QDENTGARRCPMCLELGPVVTLCMGLEPAFYVDVGAPTYAFNPCGHMAT 378
            |:.||||.|:|.||  ::.....|.||:|..:||.|.|.:|.|....:|.|.|::||.||||:.:
  Rat   335 YVRCGHVHGYHGWGCRRERGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGHVCS 399

  Fly   379 EKTVKYWANVEIPHGTNGFQAVCPFCATPLDGATGYIKLIFQDNLD 424
            |||.:|||...:||||:.|.|.||||...|.|..|.::||||..||
  Rat   400 EKTARYWAQTPLPHGTHAFHAACPFCGAWLTGELGCVRLIFQGPLD 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PliNP_001097890.1 Pellino 21..424 CDD:282553 217/410 (53%)
Peli3NP_001121014.1 Pellino 37..445 CDD:282553 217/411 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C26113704
eggNOG 1 0.900 E1_KOG3842
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 504 1.000 Inparanoid score I1265
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D251367at33208
OrthoFinder 1 1.000 FOG0000914
OrthoInspector 1 1.000 T617647
orthoMCL 1 0.900 OOG5_129859
Panther 1 1.100 O PTHR12098
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.