DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pli and Peli2

Sequence 1:NP_001097890.1 Gene:Pli FlyBaseID:FBgn0025574 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_017455153.1 Gene:Peli2 RGDID:1565884 Length:483 Species:Rattus norvegicus

Alignment Length:430 Identity:246/431 (57%)
Similarity:310/431 (72%) Gaps:14/431 (3%)


  Fly     2 VKRTDGTESPI-LAEDGGDGHDKPRLRYGELVILGYNGYLPQGDRGRRRSKFVLHKRTEASGVKR 65
            ::.|.|::.|. .:.|.|:...:..:...:     |||.||.||||||:|:|.|:|||:|:|||.
  Rat    61 LRDTRGSDPPSPTSRDSGNSEKRVLITTSK-----YNGALPNGDRGRRKSRFALYKRTKANGVKP 120

  Fly    66 SKHYIVQSPQTSKAILDANQHSISYTLSRNQAVIVEYKEDTETDMFQVGRSSESPIDFVVMDTLP 130
            |..::|.:||.||||....||||||||||||.|:|||..|.:|||||||||:||||||||.||:.
  Rat   121 STIHVVSTPQASKAISCKGQHSISYTLSRNQTVVVEYTHDNDTDMFQVGRSTESPIDFVVTDTVS 185

  Fly   131 GDKK-DAKVMQSTISRFACRILVNRCEPAKARIFAAGFDSSRNIFLGEKATKWQD-NVEIDGLTT 193
            |.:. ||::.|||||||||||:.:|.||..|||||||||||:||||||||.||:: ...:|||||
  Rat   186 GGQNDDAQITQSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPGGHMDGLTT 250

  Fly   194 NGVLIMHPKGSFCGGNAKCGLWRECSVGGDVFSLRESRSAQQKGQPIYDECNILQDGTLIDLCGA 258
            ||||:|||:|.|. ..::.|:|||.||.|||::|||:|||||:|:.:..|.|:||||:|||||||
  Rat   251 NGVLVMHPRGGFT-DESQPGVWREISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGA 314

  Fly   259 TLLWRSAEGLQHSPTKHDLEKLIDAINAGRPQCPVGLNTLVIPRKVNIGDQV--NQPYVYLNCGH 321
            |||||:|:||.|:||:..:|.|...|||.|||||||||||..| .:|..:.|  .||:.||:|||
  Rat   315 TLLWRTADGLFHAPTQKHIEALRQEINAARPQCPVGLNTLAFP-SINRKEVVEEKQPWAYLSCGH 378

  Fly   322 VQGHHDWG--QDENTGARRCPMCLELGPVVTLCMGLEPAFYVDVGAPTYAFNPCGHMATEKTVKY 384
            |.|:|.||  .|.....|.||||..:||.|.|.:|.|..||||.|.||:||.||||:.:||:.||
  Rat   379 VHGYHSWGHRSDGEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKY 443

  Fly   385 WANVEIPHGTNGFQAVCPFCATPLDGATGYIKLIFQDNLD 424
            |:.:.:||||:.|.|.||||||.|.|....||||||..:|
  Rat   444 WSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPVD 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PliNP_001097890.1 Pellino 21..424 CDD:282553 240/409 (59%)
Peli2XP_017455153.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C26114333
eggNOG 1 0.900 E1_KOG3842
Hieranoid 1 1.000
Homologene 1 1.000 H41431
Inparanoid 1 1.050 504 1.000 Inparanoid score I1265
OMA 1 1.010
OrthoDB 1 1.010 D251367at33208
OrthoFinder 1 1.000 FOG0000914
OrthoInspector 1 1.000 T617647
orthoMCL 1 0.900 OOG5_129859
Panther 1 1.100 LDO PTHR12098
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.