DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pli and PELI3

Sequence 1:NP_001097890.1 Gene:Pli FlyBaseID:FBgn0025574 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_659502.2 Gene:PELI3 HGNCID:30010 Length:469 Species:Homo sapiens

Alignment Length:448 Identity:223/449 (50%)
Similarity:292/449 (65%) Gaps:36/449 (8%)


  Fly    10 SPILAEDGGDGH--DKPRLRYGELVILG------------------------YNGYLPQGDRGRR 48
            |.:|:..|.|..  ::| ::||||::||                        |||.|..||:|||
Human    25 SCVLSSPGEDAQPGEEP-IKYGELIVLGCCEEGGEETEAQRGEVTGPRAHSCYNGCLASGDKGRR 88

  Fly    49 RSKFVLHKRTEASGVKRSKHYIVQSPQTSKAILDANQHSISYTLSRNQAVIVEYKEDTETDMFQV 113
            ||:..|.:|:.|:|||....:.:.:|..|||:.:..||||||||||:.:|||||..|::|||||:
Human    89 RSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQHSISYTLSRSHSVIVEYTHDSDTDMFQI 153

  Fly   114 GRSSESPIDFVVMDTLP-GDKKDAKVMQSTISRFACRILVNRCEPAKARIFAAGFDSSRNIFLGE 177
            |||:|:.|||||.||.| |...:....||||||:|||||.:|..|..|||:|||||:|.||||||
Human   154 GRSTENMIDFVVTDTSPGGGAAEGPSAQSTISRYACRILCDRRPPYTARIYAAGFDASSNIFLGE 218

  Fly   178 KATKWQ--DNVEIDGLTTNGVLIMHPKGSFCGGNAKCGLWRECSVGGDVFSLRESRSAQQKGQPI 240
            :|.||:  |.: :|||||||||:|||.|.|...:|. |:|||.||.|:|::||:||||||:|:.:
Human   219 RAAKWRTPDGL-MDGLTTNGVLVMHPAGGFSEDSAP-GVWREISVCGNVYTLRDSRSAQQRGKLV 281

  Fly   241 YDECNILQDGTLIDLCGATLLWRSAEGLQHSPTKHDLEKLIDAINAGRPQCPVGLNTLVI--PRK 303
            .:|.|:||||:||||||||||||:..||..:||...||......||.||||||||:||..  |.:
Human   282 ENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPAR 346

  Fly   304 VNIGDQVNQPYVYLNCGHVQGHHDWG--QDENTGARRCPMCLELGPVVTLCMGLEPAFYVDVGAP 366
            ........||:||:.||||.|:|.||  ::.....|.||:|..:||.|.|.:|.|....:|.|.|
Human   347 GRTAPDKQQPWVYVRCGHVHGYHGWGCRRERGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPP 411

  Fly   367 TYAFNPCGHMATEKTVKYWANVEIPHGTNGFQAVCPFCATPLDGATGYIKLIFQDNLD 424
            ::||.||||:.:|||.:|||...:||||:.|.|.||||...|.|..|.::||||..||
Human   412 SHAFAPCGHVCSEKTARYWAQTPLPHGTHAFHAACPFCGAWLTGEHGCVRLIFQGPLD 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PliNP_001097890.1 Pellino 21..424 CDD:282553 218/436 (50%)
PELI3NP_659502.2 Pellino 37..469 CDD:309722 218/435 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C26115281
eggNOG 1 0.900 E1_KOG3842
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 502 1.000 Inparanoid score I1341
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D251367at33208
OrthoFinder 1 1.000 FOG0000914
OrthoInspector 1 1.000 T608706
orthoMCL 1 0.900 OOG5_129859
Panther 1 1.100 O PTHR12098
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4716
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.