DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pli and peli1a

Sequence 1:NP_001097890.1 Gene:Pli FlyBaseID:FBgn0025574 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_005160243.1 Gene:peli1a ZFINID:ZDB-GENE-110310-6 Length:442 Species:Danio rerio

Alignment Length:436 Identity:229/437 (52%)
Similarity:290/437 (66%) Gaps:37/437 (8%)


  Fly    23 KPRLRYGELVILGYNGYLPQGDRGRRRSKFVLHKRTEASGVKRSKHYIVQSPQTSKAILDANQHS 87
            || ::||||::|||||.||.||||||:|:|.|.||.:|:|||.|..:...|.||::||.:..|||
Zfish    10 KP-VKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHSTCSAQTARAISNKLQHS 73

  Fly    88 ISYTLSRNQAVIVEYKEDTETDMFQVGRSSESPIDFVVMDTLPGDK--KDAKVMQSTISRFACRI 150
            :||||||.|.|:|||..|:.|||||:|||:|||||||||||..|.|  .|....|||||||||||
Zfish    74 VSYTLSRTQTVVVEYTHDSTTDMFQIGRSTESPIDFVVMDTGAGCKANSDTLTSQSTISRFACRI 138

  Fly   151 LVNRCEPAKARIFAAGFDSSRNIFLGEKATKWQ-DNVEIDGLTTNGVLIMHPKGSF-CGGNAKCG 213
            :..|..|..|.|:|||||||::|||||||.||. .:.::|||||||||:|.|:..| |  .:|.|
Zfish   139 VCQRAPPYTAHIYAAGFDSSKSIFLGEKAAKWWCSDSQMDGLTTNGVLVMRPRHGFTC--ESKPG 201

  Fly   214 LWRECSVGGDVFSLRESRSAQQKGQPIYDECNILQDGTLIDLCGATLLWRSAEGLQHSPTKHDLE 278
            .|||.||.|:||:|||:||||::|:.:..||:.|.||||||||||||||||||||..:|:...||
Zfish   202 PWREISVCGNVFTLRETRSAQKRGKLVEHECHELTDGTLIDLCGATLLWRSAEGLSRTPSLKQLE 266

  Fly   279 KLIDAINAGRPQCPVGLNTLVIP---RKVNIGDQVNQPYVYLNCGHVQGHHDW------------ 328
            :|...:||.||||||||:||..|   |.:......:||:|||.||||.|:|.|            
Zfish   267 ELRRELNAARPQCPVGLHTLAFPSLQRSIRTSSLQHQPWVYLRCGHVHGYHAWRGRRRVSKHGST 331

  Fly   329 -GQDEN--------------TGARRCPMCLELGPVVTLCMGLEPAFYVDVGAPTYAFNPCGHMAT 378
             .::||              .|.|.||:|...|..|.|.:|.|...|:|...||:|||||||:.:
Zfish   332 EEEEENEDQMEVQEGEREMVEGERECPLCRTRGLYVPLKLGRESGLYLDGAPPTHAFNPCGHVCS 396

  Fly   379 EKTVKYWANVEIPHGTNGFQAVCPFCATPLDGATGYIKLIFQDNLD 424
            |:|..:|:::.:|||.:||...||||..||......::||||..||
Zfish   397 ERTAAFWSDLLLPHGAHGFHNACPFCVRPLARDMKCVRLIFQGPLD 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PliNP_001097890.1 Pellino 21..424 CDD:282553 228/435 (52%)
peli1aXP_005160243.1 Pellino 10..442 CDD:282553 228/435 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C26112755
eggNOG 1 0.900 E1_KOG3842
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 492 1.000 Inparanoid score I1340
OMA 1 1.010
OrthoDB 1 1.010 D251367at33208
OrthoFinder 1 1.000 FOG0000914
OrthoInspector 1 1.000 T596256
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12098
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.