DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SdhD and TIM18

Sequence 1:NP_651181.1 Gene:SdhD FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_014940.4 Gene:TIM18 SGDID:S000005823 Length:192 Species:Saccharomyces cerevisiae

Alignment Length:180 Identity:38/181 (21%)
Similarity:73/181 (40%) Gaps:38/181 (21%)


  Fly    24 ITPLKSYSTLVANVQRKAVVQPLAVA---------------KI--VAPVVREISVSA-----PRM 66
            :.|:.:.||::.|..| ||...|.::               ||  :|...:|.|.|.     |..
Yeast     7 LKPVLNASTVIVNPVR-AVFPGLVLSTKRSFYSINRLNAENKINDIANTSKEASSSVQMFKPPEF 70

  Fly    67 ASAGSSHTLLWTVERIVSAGLLAVIPAAFIAP------SQVLDALMAISVVIHTHWGVEAMVVDY 125
            :....|:..  ..|||....|:.:....|.|.      :.:|||.::...:|:..:|..:.::||
Yeast    71 SQFKDSYQK--DYERIAKYTLIPLTMVPFYASFTGGVINPLLDASLSSIFLIYLQYGFTSCIIDY 133

  Fly   126 MRPSVVGNVLPKVAHIALIII---SVATLGGLFYFIQNDVGLANGIKRFW 172
                :.....|:...:||..:   |:.:|.|::.....:.|..:.:|:.|
Yeast   134 ----IPKEKYPRWHKLALYCLYGGSMLSLYGIYELETKNNGFVDLVKKLW 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 31/160 (19%)
TIM18NP_014940.4 CybS 47..180 CDD:310143 30/140 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156208185
eggNOG 1 0.900 E1_KOG4097
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I1837
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002475
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129488
Panther 1 1.100 LDO PTHR13337
Phylome 1 0.910 0.950 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.