DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SdhD and SDH4

Sequence 1:NP_651181.1 Gene:SdhD FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_010463.1 Gene:SDH4 SGDID:S000002585 Length:181 Species:Saccharomyces cerevisiae

Alignment Length:124 Identity:31/125 (25%)
Similarity:53/125 (42%) Gaps:13/125 (10%)


  Fly    61 VSAPRMASAGSSHTLLWTVERIVSAGLLAVIPAAFIAP------SQVLDALMAISVVIHTHWGVE 119
            |..|.....||.|   |.:|:|.:   |:|:|.|..|.      |...|:..::.::.:.:....
Yeast    56 VPPPENKLEGSYH---WYMEKIFA---LSVVPLATTAMLTTGPLSTAADSFFSVMLLGYCYMEFN 114

  Fly   120 AMVVDYMRPSVVGNVLPKVAHIALIIISVATLGGLFYFIQNDVGLANGIKRFWAIKGKD 178
            :.:.||:...|.| |..|.|...|.:.|..:|.|::.....:.|:...:|..|....||
Yeast   115 SCITDYISERVYG-VWHKYAMYMLGLGSAVSLFGIYKLETENDGVVGLVKSLWDSSEKD 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 29/118 (25%)
SDH4NP_010463.1 CybS 34..167 CDD:310143 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4097
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I1837
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002475
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129488
Panther 1 1.100 O PTHR13337
Phylome 1 0.910 0.950 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.820

Return to query results.
Submit another query.