DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SdhD and SHH4

Sequence 1:NP_651181.1 Gene:SdhD FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_013265.1 Gene:SHH4 SGDID:S000004154 Length:168 Species:Saccharomyces cerevisiae

Alignment Length:136 Identity:37/137 (27%)
Similarity:62/137 (45%) Gaps:15/137 (11%)


  Fly    52 VAPVVREISVSAPRMASAGSSHTLLWTVERIVSAGLLAVI--PAAFIAP-SQVLDALMAISVVIH 113
            |:....:.|...|...:.||.|   |.|||.:|..:|.:|  |.....| |...|..:::.::.|
Yeast    39 VSGTANDSSYMPPESRAQGSYH---WIVERGLSLAVLPLIAVPLVTTGPISTFTDTFLSLVLLGH 100

  Fly   114 THWGVEAMVVDYMRPSVVGNVLPKVAHIALIIISVA---TLGGLFYFIQNDVGLANGIKRFWAIK 175
            .|.|.::.::||:...|.|    ||.|.|:.::|:.   :..|::.....:.||...:|..|  .
Yeast   101 CHIGFQSCIIDYISERVYG----KVHHYAMYLLSLGSFLSFVGIYKLESQEAGLIASLKSLW--D 159

  Fly   176 GKDAEK 181
            .|..||
Yeast   160 NKPVEK 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 34/127 (27%)
SHH4NP_013265.1 CybS 26..159 CDD:310143 34/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4097
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I1837
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002475
OrthoInspector 1 1.000 T1136261
orthoMCL 1 0.900 OOG5_129488
Panther 1 1.100 O PTHR13337
Phylome 1 0.910 0.964 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R310
TreeFam 1 0.960
109.850

Return to query results.
Submit another query.