DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SdhD and Sdhd

Sequence 1:NP_651181.1 Gene:SdhD FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_080124.1 Gene:Sdhd MGIID:1914175 Length:159 Species:Mus musculus

Alignment Length:186 Identity:55/187 (29%)
Similarity:86/187 (46%) Gaps:41/187 (22%)


  Fly     3 LSLLLRGAVRCNAANLVKSARITPLKSYSTLVANVQRKAVVQPLAVAKIVAPVVREISVSAPRMA 67
            :::||:..|.|:.    :.||           |.:.|..||:|..|:..:.        ..|...
Mouse     1 MAVLLKLGVLCSG----QGAR-----------ALLLRSRVVRPAYVSAFLQ--------DQPTQG 42

  Fly    68 SAGSSH--------------TLLWTVERIVSAGLLAVIPAAFIAPSQVLDALMAISVVIHTHWGV 118
            ..|:.|              :|.||.||:||..||.:|||.::.|..|:|..:|.::.:|:|||:
Mouse    43 RCGTQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGL 107

  Fly   119 EAMVVDYMRPSVVGNVLPKVAHIALIIISVATLGGLFYFIQNDVGLANGIKRFWAI 174
            ..:|.||    |.|:.|||.|...|:.:|..|..||.||..:|||:...:...|.:
Mouse   108 GQVVTDY----VHGDTLPKAARAGLLALSALTFAGLCYFNYHDVGICRAVAMLWKL 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 45/142 (32%)
SdhdNP_080124.1 SQR_TypeC_CybS 60..158 CDD:239576 40/102 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156199903
eggNOG 1 0.900 E1_KOG4097
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5104
Isobase 1 0.950 0 Normalized mean entropy S6445
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002475
OrthoInspector 1 1.000 T1083930
orthoMCL 1 0.900 OOG5_129488
Panther 1 1.100 LDO PTHR13337
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R310
TreeFam 1 0.960
1211.730

Return to query results.
Submit another query.