DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SdhD and SDHD

Sequence 1:NP_651181.1 Gene:SdhD FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_002993.1 Gene:SDHD HGNCID:10683 Length:159 Species:Homo sapiens

Alignment Length:143 Identity:48/144 (33%)
Similarity:76/144 (53%) Gaps:12/144 (8%)


  Fly    39 RKAVVQPLAVAKIV--APV-----VREISVSAPRMASAGSSHTLLWTVERIVSAGLLAVIPAAFI 96
            |..||:|..::..:  .|:     |:.|.:| |...|...:.:|.||.||:||..||.::|||::
Human    22 RTPVVRPAHISAFLQDRPIPEWCGVQHIHLS-PSHHSGSKAASLHWTSERVVSVLLLGLLPAAYL 85

  Fly    97 APSQVLDALMAISVVIHTHWGVEAMVVDYMRPSVVGNVLPKVAHIALIIISVATLGGLFYFIQND 161
            .|...:|..:|.::.:|.|||:..:|.||    |.|:.|.|.|...|:.:|..|..||.||..:|
Human    86 NPCSAMDYSLAAALTLHGHWGLGQVVTDY----VHGDALQKAAKAGLLALSALTFAGLCYFNYHD 146

  Fly   162 VGLANGIKRFWAI 174
            ||:...:...|.:
Human   147 VGICKAVAMLWKL 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 45/135 (33%)
SDHDNP_002993.1 SQR_TypeC_CybS 60..158 CDD:239576 38/102 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156203703
eggNOG 1 0.900 E1_KOG4097
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5117
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1511215at2759
OrthoFinder 1 1.000 FOG0002475
OrthoInspector 1 1.000 T609659
orthoMCL 1 0.900 OOG5_129488
Panther 1 1.100 O PTHR13337
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R310
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.