DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SdhD and sdhdb

Sequence 1:NP_651181.1 Gene:SdhD FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001004004.1 Gene:sdhdb ZFINID:ZDB-GENE-040822-17 Length:158 Species:Danio rerio

Alignment Length:141 Identity:45/142 (32%)
Similarity:77/142 (54%) Gaps:15/142 (11%)


  Fly    41 AVVQPLAVAK-------IVAPVVREISVSAPRMASAGS-SHTLLWTVERIVSAGLLAVIPAAFIA 97
            ::::||||.:       :::   ..|..:....|.:|| :.|:.||.|||:|..||::.|.|:..
Zfish    24 SLIRPLAVQQKDHDCSYLIS---ARIHATPSNYAGSGSKAATMHWTGERILSIALLSLAPVAYFC 85

  Fly    98 PSQVLDALMAISVVIHTHWGVEAMVVDYMRPSVVGNVLPKVAHIALIIISVATLGGLFYFIQNDV 162
            ||..:|..:|.::.:|.|||:..:|.||    |.|:...|:|:..|.::|..|..||.||..:||
Zfish    86 PSPAVDYSLAAALTLHGHWGLGQVVTDY----VHGDAKIKMANAGLFVLSTVTFAGLCYFNYHDV 146

  Fly   163 GLANGIKRFWA 173
            |:...:...|:
Zfish   147 GICKAVALLWS 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 45/136 (33%)
sdhdbNP_001004004.1 SQR_TypeC_CybS 59..157 CDD:239576 37/102 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156203828
eggNOG 1 0.900 E1_KOG4097
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5120
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1511215at2759
OrthoFinder 1 1.000 FOG0002475
OrthoInspector 1 1.000 T597326
orthoMCL 1 0.900 OOG5_129488
Panther 1 1.100 LDO PTHR13337
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R310
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.