DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SdhD and sdhda

Sequence 1:NP_651181.1 Gene:SdhD FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001002489.1 Gene:sdhda ZFINID:ZDB-GENE-040718-192 Length:154 Species:Danio rerio

Alignment Length:125 Identity:42/126 (33%)
Similarity:68/126 (54%) Gaps:10/126 (8%)


  Fly    54 PVVREISVSAP------RMASAGSSHTLLWTVERIVSAGLLAVIPAAFIAPSQVLDALMAISVVI 112
            |.:.::..:.|      ..:|.|.|.:..||.||:::..||.:.|||::.|..|:|..:|.::.:
Zfish    32 PRIGDVDYTEPAGRIHTASSSTGISASQHWTGERVMTLVLLGMAPAAYLCPGPVVDYSIAAALTM 96

  Fly   113 HTHWGVEAMVVDYMRPSVVGNVLPKVAHIALIIISVATLGGLFYFIQNDVGLANGIKRFW 172
            |.|||:..::.||    |.|.|..|:|.:.:.::|.||..||.||..|||||...:...|
Zfish    97 HGHWGIGQVLTDY----VHGEVKIKLAKVGIFLLSTATFFGLCYFNYNDVGLCKAVVMLW 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 42/126 (33%)
sdhdaNP_001002489.1 SQR_TypeC_CybS 56..152 CDD:239576 37/100 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156203137
eggNOG 1 0.900 E1_KOG4097
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5120
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1511215at2759
OrthoFinder 1 1.000 FOG0002475
OrthoInspector 1 1.000 T597326
orthoMCL 1 0.900 OOG5_129488
Panther 1 1.100 O PTHR13337
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.