DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SdhD and sdhd

Sequence 1:NP_651181.1 Gene:SdhD FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_989357.1 Gene:sdhd XenbaseID:XB-GENE-5855162 Length:152 Species:Xenopus tropicalis

Alignment Length:174 Identity:48/175 (27%)
Similarity:83/175 (47%) Gaps:22/175 (13%)


  Fly     1 MSLSLLLRGAVRCNAANLVKSARITPLKSYSTLVANVQRKAVVQPLAVAKIVAPVVREISVSAPR 65
            |:..|.:....|.|.|:..||..|.|:...:      |...:||...:.            ::|.
 Frog     1 MATLLRVSSLCRANRASAFKSLLIRPVPCLT------QDHHMVQTSQIH------------TSPN 47

  Fly    66 MASAGSSHTLLWTVERIVSAGLLAVIPAAFIAPSQVLDALMAISVVIHTHWGVEAMVVDYMRPSV 130
            ..:...:.::.||.||.:|..||.::|||::.|...:|..:|.::.:|.|||:..:|.||    |
 Frog    48 HHAGSKAASMHWTSERALSVALLGLLPAAYLYPGAAMDYSLAAALTLHGHWGLGQVVTDY----V 108

  Fly   131 VGNVLPKVAHIALIIISVATLGGLFYFIQNDVGLANGIKRFWAI 174
            .|:...|:|:.:|..:|..|..||.||..:|||:...:...|::
 Frog   109 HGDAKIKMANTSLFALSALTFAGLCYFNYHDVGICKAVSMLWSL 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 36/128 (28%)
sdhdNP_989357.1 SQR_TypeC_CybS 53..151 CDD:239576 35/102 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156200393
eggNOG 1 0.900 E1_KOG4097
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I4961
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1511215at2759
OrthoFinder 1 1.000 FOG0002475
OrthoInspector 1 1.000 T1059911
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R310
TreeFam 1 0.960
109.790

Return to query results.
Submit another query.