DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdhD and Sdhd

DIOPT Version :9

Sequence 1:NP_651181.1 Gene:SdhD / 42808 FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_942083.1 Gene:Sdhd / 363061 RGDID:735231 Length:159 Species:Rattus norvegicus


Alignment Length:175 Identity:56/175 - (32%)
Similarity:86/175 - (49%) Gaps:19/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSLLLRGAVRCNAANLVKSARITPLKSYSTLVANVQRKAVVQPLAVAKIVAPVVR---EISVSAP 64
            :::||:..|.|:.    :.||...|:|.:...|.|......||       .|..|   .|.:| |
  Rat     1 MAVLLKLGVLCSG----QGARALSLRSRAVRPAFVSAFLQDQP-------TPGWRGTQHIHLS-P 53

  Fly    65 RMASAGSSHTLLWTVERIVSAGLLAVIPAAFIAPSQVLDALMAISVVIHTHWGVEAMVVDYMRPS 129
            ...|...:.:|.||.||:||..||.:|||.::.|..|:|..:|.::.:|:|||:..:|.||    
  Rat    54 SHQSGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGIGQVVTDY---- 114

  Fly   130 VVGNVLPKVAHIALIIISVATLGGLFYFIQNDVGLANGIKRFWAI 174
            |.|:.|.|.....|:.:|..|..||.||..:|||:...:...|.:
  Rat   115 VHGDALQKATKAGLLAVSALTFAGLCYFNYHDVGICRAVAMLWKL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 44/130 (34%)
SdhdNP_942083.1 SQR_TypeC_CybS 60..158 CDD:239576 37/101 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343976
Domainoid 1 1.000 83 1.000 Domainoid score I8170
eggNOG 1 0.900 - - E1_KOG4097
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5082
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511215at2759
OrthoFinder 1 1.000 - - FOG0006285
OrthoInspector 1 1.000 - - oto98214
orthoMCL 1 0.900 - - OOG6_103841
Panther 1 1.100 - - LDO PTHR13337
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5239
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.