DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SdhD and Sdhd

Sequence 1:NP_651181.1 Gene:SdhD FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_942083.1 Gene:Sdhd RGDID:735231 Length:159 Species:Rattus norvegicus

Alignment Length:175 Identity:56/176 (32%)
Similarity:86/176 (49%) Gaps:19/176 (11%)


  Fly     3 LSLLLRGAVRCNAANLVKSARITPLKSYSTLVANVQRKAVVQPLAVAKIVAPVVR---EISVSAP 64
            :::||:..|.|:.    :.||...|:|.:...|.|......||       .|..|   .|.:| |
  Rat     1 MAVLLKLGVLCSG----QGARALSLRSRAVRPAFVSAFLQDQP-------TPGWRGTQHIHLS-P 53

  Fly    65 RMASAGSSHTLLWTVERIVSAGLLAVIPAAFIAPSQVLDALMAISVVIHTHWGVEAMVVDYMRPS 129
            ...|...:.:|.||.||:||..||.:|||.::.|..|:|..:|.::.:|:|||:..:|.||    
  Rat    54 SHQSGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGIGQVVTDY---- 114

  Fly   130 VVGNVLPKVAHIALIIISVATLGGLFYFIQNDVGLANGIKRFWAI 174
            |.|:.|.|.....|:.:|..|..||.||..:|||:...:...|.:
  Rat   115 VHGDALQKATKAGLLAVSALTFAGLCYFNYHDVGICRAVAMLWKL 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 45/131 (34%)
SdhdNP_942083.1 SQR_TypeC_CybS 60..158 CDD:239576 38/102 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156204215
eggNOG 1 0.900 E1_KOG4097
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5011
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1511215at2759
OrthoFinder 1 1.000 FOG0002475
OrthoInspector 1 1.000 T1087481
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13337
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.