DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SdhD and sdhd-1

Sequence 1:NP_651181.1 Gene:SdhD FlyBaseID:FBgn0039112 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_496369.1 Gene:sdhd-1 WormBaseID:WBGene00009353 Length:145 Species:Caenorhabditis elegans

Alignment Length:146 Identity:43/147 (29%)
Similarity:82/147 (56%) Gaps:5/147 (3%)


  Fly    33 LVANVQRKAVVQPLAVAKIVAPVVREISVSAPRMASAGSS----HTLLWTVERIVSAGLLAVIPA 93
            :.|:::..|..|...:....||.:..| |.|....:.|:|    |::.:.:||:.:.|:|.::||
 Worm     1 MAASLRHMAHFQKALLVARSAPRISTI-VRATSTLNDGASKVPDHSMHFKLERLWAVGMLPILPA 64

  Fly    94 AFIAPSQVLDALMAISVVIHTHWGVEAMVVDYMRPSVVGNVLPKVAHIALIIISVATLGGLFYFI 158
            ::.....|:||::.:::.:|.|||:..:|.||.||.|:|....|.||:.:.:|:...||.|.:|.
 Worm    65 SYFIHGPVMDAVLTVALTLHIHWGIHGVVYDYARPYVIGEAAAKAAHVGVYLITGLLLGALLHFN 129

  Fly   159 QNDVGLANGIKRFWAI 174
            .||||:....:..:::
 Worm   130 TNDVGITKAFELVFSL 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdhDNP_651181.1 CybS 45..173 CDD:283083 40/132 (30%)
sdhd-1NP_496369.1 SQR_TypeC_CybS 43..144 CDD:239576 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C154355157
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I3679
Isobase 1 0.950 0 Normalized mean entropy S6445
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1511215at2759
OrthoFinder 1 1.000 FOG0002475
OrthoInspector 1 1.000 T475825
orthoMCL 1 0.900 OOG5_129488
Panther 1 1.100 LDO PTHR13337
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R310
TreeFam 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.