DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nau and myf5

Sequence 1:NP_476650.1 Gene:nau FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_571651.1 Gene:myf5 ZFINID:ZDB-GENE-000616-6 Length:237 Species:Danio rerio

Alignment Length:221 Identity:92/222 (41%)
Similarity:125/222 (56%) Gaps:29/222 (13%)


  Fly   120 ENSSLSSEEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEIL 184
            |.:....:|||.||   .:......||.|||||||:|:.|||||:||||||||||:|||.|||.|
Zfish    29 ELTGSEEDEHVRAP---GAPHQPGHCLQWACKACKRKASTVDRRRAATMRERRRLKKVNHAFEAL 90

  Fly   185 KRRTSSNPNQRLPKVEILRNAIEYIESLEDLLQES-----STTRDGDNLAPSLSGKSCQSDYLSS 244
            :|.||:||:|||||||||||||:|||||::||:|.     |...:..: .|:....||....:..
Zfish    91 RRCTSANPSQRLPKVEILRNAIQYIESLQELLREQVEQYYSLPMESSS-EPASPSSSCSESMVDC 154

  Fly   245 YAGAYLEDKLSFYNKHMEKYGQFTDFDG-NANG-------SSLDCLNLIVQSINKSTTSPIQNKA 301
            .:..:.:..        :.||...:||. ||:.       |||.||:.||..::....:.::|..
Zfish   155 NSPVWPQMN--------QNYGNSYNFDAQNASTMERTPGVSSLQCLSSIVDRLSSVDPAGMRNMV 211

  Fly   302 --TPSASDTQ-SPPSSGATAPTSLHV 324
              :|:.||:| |.|.|....|. .||
Zfish   212 VLSPTGSDSQSSSPDSPNNRPV-YHV 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 22/46 (48%)
HLH 162..213 CDD:278439 42/51 (82%)
myf5NP_571651.1 BASIC 4..72 CDD:128794 22/46 (48%)
HLH 68..119 CDD:278439 42/51 (82%)
Myf5 <151..199 CDD:289036 13/56 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16373032
eggNOG 1 0.900 E1_KOG3960
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000646
OrthoInspector 1 1.000 T596402
orthoMCL 1 0.900 OOG5_137851
Panther 1 1.100 O PTHR11534
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2661
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.