DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nau and myf6

Sequence 1:NP_476650.1 Gene:nau FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_012814547.1 Gene:myf6 XenbaseID:XB-GENE-998203 Length:244 Species:Xenopus tropicalis

Alignment Length:200 Identity:91/200 (46%)
Similarity:115/200 (58%) Gaps:19/200 (10%)


  Fly   104 GMNMTPSPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSRP--CLTWACKACKKKSVTVDRRKAA 166
            |...|.||.......|..|..|.|||||||   ...|...|  ||.||||.||:||...||||||
 Frog    35 GSEGTLSPCRDQLPADAGSDSSEEEHVLAP---PGLQPHCPGQCLIWACKTCKRKSAPTDRRKAA 96

  Fly   167 TMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEYIESLEDLL-----QESSTTRDGD 226
            |:||||||:|:|||||.|||||.:|||||||||||||:||.|||.|:|||     |:.....|.:
 Frog    97 TLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAINYIERLQDLLHSLDQQDKPPKADEE 161

  Fly   227 ----NLAPSLSGKSCQSDYLSSY--AGAYLEDKLSFYNKHMEKYGQFTDFDGNANGSSLDCLNLI 285
                |...:...|....|:|::.  ...::.|.....|.::::.|...:   |::.|||.||:.|
 Frog   162 PFSYNSKEAAVSKVQSEDFLNTCHPEWHHIPDHSRMPNLNIKEEGSLQE---NSSSSSLQCLSSI 223

  Fly   286 VQSIN 290
            |.||:
 Frog   224 VDSIS 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 31/64 (48%)
HLH 162..213 CDD:278439 42/51 (82%)
myf6XP_012814547.1 BASIC 2..96 CDD:128794 31/64 (48%)
HLH 92..143 CDD:278439 42/51 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16380042
eggNOG 1 0.900 E1_KOG3960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000646
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.700

Return to query results.
Submit another query.