DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nau and myod1

Sequence 1:NP_476650.1 Gene:nau FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_571337.2 Gene:myod1 ZFINID:ZDB-GENE-980526-561 Length:275 Species:Danio rerio

Alignment Length:232 Identity:96/233 (41%)
Similarity:123/233 (53%) Gaps:45/233 (19%)


  Fly   119 DENSSLSSEEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEI 183
            ||:..: .:|||.||   |....:..||.|||||||:|:...||||||||||||||.|||:|||.
Zfish    46 DEHHHI-EDEHVRAP---SGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNDAFET 106

  Fly   184 LKRRTSSNPNQRLPKVEILRNAIEYIESLEDLLQESST---------TRDGDNLAP--------- 230
            |||.||:||||||||||||||||.|||||:.||:....         :.|.|..:|         
Zfish   107 LKRCTSTNPNQRLPKVEILRNAISYIESLQALLRSQEDNYYPVLEHYSGDSDASSPRSNCSDGMM 171

  Fly   231 SLSGKSCQSDYLSSYAGAYLEDKLSFYNKHMEKYGQFTDFDGNANG--SSLDCLNLIVQSINKST 293
            ...|.:||:...:||..:|..|..:            .|...|.|.  ||||||:.||:.|:..|
Zfish   172 DFMGPTCQTRRRNSYDSSYFNDTPN------------ADARNNKNSVVSSLDCLSSIVERISTET 224

  Fly   294 TS-PI--------QNKATPSASDTQSPPSSGATAPTS 321
            .: |:        ::..:|......|...:.|.:|||
Zfish   225 PACPVLSVPEGHEESPCSPHEGSVLSDTGTTAPSPTS 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 23/47 (49%)
HLH 162..213 CDD:278439 45/51 (88%)
myod1NP_571337.2 BASIC 1..89 CDD:128794 23/47 (49%)
HLH 85..136 CDD:278439 45/51 (88%)
Myf5 151..220 CDD:289036 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16383187
eggNOG 1 0.900 E1_KOG3960
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4394
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000646
OrthoInspector 1 1.000 T596402
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11534
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2661
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.