DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nau and myog

Sequence 1:NP_476650.1 Gene:nau FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_571081.1 Gene:myog ZFINID:ZDB-GENE-980526-265 Length:256 Species:Danio rerio

Alignment Length:293 Identity:102/294 (35%)
Similarity:134/294 (46%) Gaps:84/294 (29%)


  Fly    40 QQNPIAHPGQNPHQTLQNFFSRFNAVGDASAGNGG---AASISANGSGSSCNYSHANHNPVEL-D 100
            :.||.....|..::...|||.        |..|||   |.....|.....|.........|.| |
Zfish     5 ETNPYFFNDQRFYEGADNFFQ--------SRINGGFEQAGYQDRNSMMGLCGDGRMLTTTVGLED 61

  Fly   101 KP-----LGMNMTPSPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTV 160
            ||     ||::|:|.              ..::|      |..     .||.||||.||:||||:
Zfish    62 KPSPSSSLGLSMSPH--------------QEQQH------CPG-----QCLPWACKVCKRKSVTM 101

  Fly   161 DRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEYIESLEDLLQE-SSTTRD 224
            |||||||:||:|||:|||||||.|||.|..|||||||||||||:||:|||.|:.|:.. :....:
Zfish   102 DRRKAATLREKRRLKKVNEAFEALKRSTLMNPNQRLPKVEILRSAIQYIERLQALVSSLNQQEHE 166

  Fly   225 GDNL-------APSL---------SGKSC--------QSDY-LSSYAGAYLEDKLSFYNKHMEKY 264
            ..||       ||..         ||.:|        .||: :.:|:.|: ||.|:         
Zfish   167 QGNLHYRATAAAPHTGVSSSSDQGSGSTCCSSPEWSSASDHCVPAYSSAH-EDLLN--------- 221

  Fly   265 GQFTDFDGNANGSSLDCLNLIVQSINKSTTSPI 297
                  |.::..|:|..|..||.||..:..:|:
Zfish   222 ------DDSSEQSNLRSLTSIVDSITGTEATPV 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 28/83 (34%)
HLH 162..213 CDD:278439 41/51 (80%)
myogNP_571081.1 BASIC 1..107 CDD:128794 41/135 (30%)
HLH 103..154 CDD:278439 41/51 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16380302
eggNOG 1 0.900 E1_KOG3960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000646
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11534
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.